Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XH45

Protein Details
Accession A0A1Y1XH45    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-40VYGHRLVHKIQKKKNQPLILHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 5.5cyto_nucl 5.5, extr 5, nucl 4.5, E.R. 4, golg 3, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035992  Ricin_B-like_lectins  
IPR000772  Ricin_B_lectin  
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS50231  RICIN_B_LECTIN  
CDD cd00161  RICIN  
Amino Acid Sequences MNNILSFLFGVGTCIILFLVVYGHRLVHKIQKKKNQPLILMPFKMLLQEWIFVLLNAGINDENDQEGSIIEQKPLEANHLQYWEFESESAKENNKYLIKLKGTTLYLTPSSNKINSPIILKELSKDENQYWILIEQHPIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.04
6 0.06
7 0.05
8 0.07
9 0.07
10 0.08
11 0.09
12 0.11
13 0.13
14 0.21
15 0.3
16 0.38
17 0.46
18 0.56
19 0.65
20 0.75
21 0.82
22 0.78
23 0.73
24 0.72
25 0.72
26 0.69
27 0.59
28 0.49
29 0.41
30 0.34
31 0.32
32 0.23
33 0.17
34 0.1
35 0.1
36 0.1
37 0.11
38 0.11
39 0.1
40 0.11
41 0.08
42 0.08
43 0.08
44 0.08
45 0.06
46 0.06
47 0.07
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.04
54 0.05
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.09
61 0.09
62 0.12
63 0.1
64 0.11
65 0.13
66 0.15
67 0.15
68 0.14
69 0.16
70 0.14
71 0.13
72 0.12
73 0.11
74 0.1
75 0.13
76 0.16
77 0.16
78 0.16
79 0.17
80 0.23
81 0.23
82 0.24
83 0.24
84 0.29
85 0.29
86 0.3
87 0.31
88 0.3
89 0.3
90 0.29
91 0.26
92 0.23
93 0.22
94 0.22
95 0.22
96 0.21
97 0.23
98 0.24
99 0.24
100 0.23
101 0.26
102 0.26
103 0.27
104 0.25
105 0.25
106 0.26
107 0.25
108 0.24
109 0.25
110 0.27
111 0.26
112 0.28
113 0.26
114 0.29
115 0.3
116 0.28
117 0.25
118 0.24
119 0.24
120 0.22