Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WVX2

Protein Details
Accession A0A1Y1WVX2   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-124SNHVKLQKLQKSKMKNEKKTCIDKELLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences MKSKYINNNNNNNNNNIKNNNSNNNNNNNIIRNILDSYNCFKKEDFEYATCFEYLKNFLKSYYYFVSSNIVNSEYITYSKFYISYKYVVLVKKKKLVSNHVKLQKLQKSKMKNEKKTCIDKELLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.6
3 0.54
4 0.5
5 0.49
6 0.54
7 0.58
8 0.58
9 0.61
10 0.62
11 0.65
12 0.64
13 0.58
14 0.54
15 0.48
16 0.42
17 0.35
18 0.28
19 0.23
20 0.21
21 0.19
22 0.17
23 0.16
24 0.21
25 0.26
26 0.26
27 0.25
28 0.23
29 0.26
30 0.28
31 0.32
32 0.3
33 0.25
34 0.27
35 0.28
36 0.29
37 0.26
38 0.22
39 0.16
40 0.14
41 0.16
42 0.17
43 0.18
44 0.17
45 0.17
46 0.19
47 0.2
48 0.22
49 0.2
50 0.19
51 0.16
52 0.17
53 0.18
54 0.16
55 0.16
56 0.13
57 0.12
58 0.09
59 0.09
60 0.09
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.13
70 0.14
71 0.15
72 0.15
73 0.16
74 0.21
75 0.24
76 0.33
77 0.37
78 0.4
79 0.46
80 0.5
81 0.52
82 0.53
83 0.59
84 0.61
85 0.63
86 0.67
87 0.68
88 0.68
89 0.67
90 0.71
91 0.69
92 0.67
93 0.65
94 0.64
95 0.65
96 0.72
97 0.79
98 0.81
99 0.83
100 0.84
101 0.86
102 0.88
103 0.89
104 0.84
105 0.8