Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WUM4

Protein Details
Accession A0A1Y1WUM4   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-69VSEHNKNKKKINKNDIWNDDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007052  CS_dom  
IPR026697  DNAAF6  
IPR008978  HSP20-like_chaperone  
IPR041442  PIH1D1/2/3_CS-like  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
GO:0070286  P:axonemal dynein complex assembly  
Pfam View protein in Pfam  
PF18201  PIH1_CS  
PROSITE View protein in PROSITE  
PS51203  CS  
CDD cd00298  ACD_sHsps_p23-like  
Amino Acid Sequences MEGSSILALSNLLKDSQYEADKKYKKEENSYNPGLIGDKKKKTTTIEDIVSEHNKNKKKINKNDIWNDDDVDEEFIEEDPRTEPEYDLIYRQKVTTEDIYLGMSGKTPGFQDCDEMVITVKLPGVKKISDIELTVYENKIDVKTSTYRLNLPLPKPILENDGNAKWKKDKSELVLNLPLKKEFSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.14
3 0.19
4 0.23
5 0.24
6 0.28
7 0.38
8 0.44
9 0.46
10 0.5
11 0.53
12 0.53
13 0.6
14 0.66
15 0.65
16 0.68
17 0.69
18 0.62
19 0.54
20 0.49
21 0.41
22 0.37
23 0.37
24 0.36
25 0.38
26 0.42
27 0.44
28 0.48
29 0.5
30 0.53
31 0.51
32 0.49
33 0.46
34 0.43
35 0.43
36 0.43
37 0.42
38 0.36
39 0.32
40 0.33
41 0.36
42 0.37
43 0.44
44 0.5
45 0.57
46 0.66
47 0.71
48 0.72
49 0.76
50 0.82
51 0.79
52 0.73
53 0.63
54 0.53
55 0.43
56 0.35
57 0.26
58 0.17
59 0.12
60 0.08
61 0.07
62 0.06
63 0.07
64 0.06
65 0.07
66 0.06
67 0.08
68 0.09
69 0.1
70 0.09
71 0.1
72 0.13
73 0.13
74 0.15
75 0.16
76 0.15
77 0.15
78 0.15
79 0.15
80 0.13
81 0.15
82 0.13
83 0.12
84 0.12
85 0.12
86 0.12
87 0.11
88 0.11
89 0.08
90 0.07
91 0.06
92 0.05
93 0.06
94 0.06
95 0.07
96 0.09
97 0.09
98 0.12
99 0.11
100 0.13
101 0.12
102 0.12
103 0.11
104 0.09
105 0.09
106 0.07
107 0.08
108 0.09
109 0.1
110 0.12
111 0.15
112 0.15
113 0.16
114 0.18
115 0.2
116 0.18
117 0.18
118 0.17
119 0.16
120 0.19
121 0.19
122 0.17
123 0.14
124 0.14
125 0.14
126 0.13
127 0.12
128 0.1
129 0.13
130 0.16
131 0.2
132 0.24
133 0.25
134 0.27
135 0.3
136 0.37
137 0.4
138 0.38
139 0.43
140 0.4
141 0.39
142 0.39
143 0.37
144 0.35
145 0.29
146 0.31
147 0.29
148 0.33
149 0.38
150 0.38
151 0.4
152 0.4
153 0.43
154 0.46
155 0.48
156 0.49
157 0.49
158 0.58
159 0.6
160 0.6
161 0.64
162 0.62
163 0.6
164 0.55
165 0.5