Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XGB1

Protein Details
Accession A0A1Y1XGB1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MRDKWRKKRQRRLKRKRRKMRARSKKSVINGBasic
NLS Segment(s)
PositionSequence
4-26KWRKKRQRRLKRKRRKMRARSKK
Subcellular Location(s) nucl 14.5, mito_nucl 13.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MRDKWRKKRQRRLKRKRRKMRARSKKSVINGLLNAYGKHFVILSFLKQKQNEYLINVLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.97
4 0.97
5 0.97
6 0.97
7 0.96
8 0.96
9 0.95
10 0.93
11 0.89
12 0.84
13 0.76
14 0.73
15 0.64
16 0.55
17 0.46
18 0.37
19 0.33
20 0.27
21 0.24
22 0.17
23 0.15
24 0.11
25 0.11
26 0.1
27 0.07
28 0.1
29 0.11
30 0.15
31 0.22
32 0.27
33 0.33
34 0.34
35 0.37
36 0.39
37 0.44
38 0.42
39 0.39