Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8P7I7

Protein Details
Accession B8P7I7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-118LDYYKQKTKKAKEAQQRAFRKLHydrophilic
120-140KPYATRLRKPLPKRKPPPAASHydrophilic
NLS Segment(s)
PositionSequence
103-137KTKKAKEAQQRAFRKLAKPYATRLRKPLPKRKPPP
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006594  LisH  
KEGG ppl:POSPLDRAFT_101031  -  
Pfam View protein in Pfam  
PF08513  LisH  
PROSITE View protein in PROSITE  
PS50896  LISH  
Amino Acid Sequences MATNIGLDPCEWPERPSTPWDGEVMFNAYIYEYLAKRGYVATAHALLKEARLPKGYKPPILTPQGLLYESAQWWCTFWVFFEGNREGSDYDDLNTYLDYYKQKTKKAKEAQQRAFRKLAKPYATRLRKPLPKRKPPPAASEVPATSPYEPESRSSAAQHACSSEVPISVCPQMEQPLVVQPVHHYQYSGQHWVDPASYAEAAAPVQHEHTTWEAGVLSGHQPMYQTEDQAFAFLGAPHEISSGQTEQLNYTPQNSPSSIESSISPTTPTFLQHFSNGYTEQMPWDMKAAYSPPVADAGNIYHPQADFDWQLGGFLPSTDNTTVFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.33
4 0.36
5 0.34
6 0.35
7 0.36
8 0.32
9 0.3
10 0.29
11 0.28
12 0.21
13 0.17
14 0.16
15 0.14
16 0.12
17 0.12
18 0.14
19 0.1
20 0.14
21 0.15
22 0.15
23 0.15
24 0.16
25 0.16
26 0.13
27 0.15
28 0.16
29 0.19
30 0.2
31 0.2
32 0.21
33 0.19
34 0.2
35 0.23
36 0.23
37 0.21
38 0.25
39 0.27
40 0.31
41 0.42
42 0.47
43 0.47
44 0.47
45 0.51
46 0.55
47 0.58
48 0.53
49 0.44
50 0.42
51 0.39
52 0.35
53 0.29
54 0.22
55 0.19
56 0.19
57 0.18
58 0.15
59 0.13
60 0.13
61 0.13
62 0.13
63 0.1
64 0.1
65 0.14
66 0.14
67 0.15
68 0.21
69 0.22
70 0.22
71 0.23
72 0.23
73 0.18
74 0.18
75 0.2
76 0.14
77 0.12
78 0.13
79 0.12
80 0.11
81 0.11
82 0.1
83 0.09
84 0.11
85 0.13
86 0.16
87 0.25
88 0.29
89 0.37
90 0.45
91 0.52
92 0.59
93 0.67
94 0.72
95 0.74
96 0.8
97 0.82
98 0.83
99 0.82
100 0.76
101 0.73
102 0.67
103 0.61
104 0.58
105 0.56
106 0.53
107 0.49
108 0.51
109 0.55
110 0.59
111 0.57
112 0.57
113 0.58
114 0.59
115 0.67
116 0.71
117 0.71
118 0.74
119 0.79
120 0.83
121 0.84
122 0.8
123 0.78
124 0.73
125 0.66
126 0.57
127 0.53
128 0.43
129 0.34
130 0.31
131 0.24
132 0.18
133 0.14
134 0.14
135 0.13
136 0.13
137 0.13
138 0.15
139 0.15
140 0.16
141 0.16
142 0.19
143 0.18
144 0.19
145 0.18
146 0.16
147 0.15
148 0.14
149 0.14
150 0.1
151 0.1
152 0.09
153 0.09
154 0.1
155 0.1
156 0.1
157 0.09
158 0.09
159 0.1
160 0.1
161 0.1
162 0.09
163 0.12
164 0.13
165 0.13
166 0.12
167 0.11
168 0.16
169 0.18
170 0.17
171 0.14
172 0.13
173 0.21
174 0.24
175 0.27
176 0.22
177 0.21
178 0.21
179 0.22
180 0.21
181 0.15
182 0.12
183 0.09
184 0.09
185 0.08
186 0.08
187 0.07
188 0.07
189 0.07
190 0.07
191 0.05
192 0.07
193 0.07
194 0.07
195 0.08
196 0.1
197 0.1
198 0.1
199 0.1
200 0.08
201 0.08
202 0.08
203 0.08
204 0.07
205 0.08
206 0.08
207 0.08
208 0.08
209 0.09
210 0.16
211 0.15
212 0.16
213 0.14
214 0.17
215 0.16
216 0.16
217 0.16
218 0.09
219 0.09
220 0.09
221 0.09
222 0.08
223 0.08
224 0.08
225 0.08
226 0.08
227 0.08
228 0.11
229 0.11
230 0.11
231 0.13
232 0.13
233 0.14
234 0.15
235 0.18
236 0.16
237 0.18
238 0.21
239 0.21
240 0.24
241 0.24
242 0.24
243 0.23
244 0.26
245 0.23
246 0.21
247 0.2
248 0.21
249 0.22
250 0.2
251 0.19
252 0.15
253 0.16
254 0.16
255 0.18
256 0.16
257 0.18
258 0.19
259 0.21
260 0.22
261 0.22
262 0.25
263 0.23
264 0.22
265 0.2
266 0.18
267 0.17
268 0.19
269 0.18
270 0.15
271 0.17
272 0.15
273 0.14
274 0.17
275 0.17
276 0.17
277 0.17
278 0.17
279 0.15
280 0.18
281 0.18
282 0.15
283 0.15
284 0.14
285 0.19
286 0.2
287 0.19
288 0.19
289 0.19
290 0.21
291 0.21
292 0.22
293 0.17
294 0.17
295 0.18
296 0.16
297 0.16
298 0.15
299 0.15
300 0.11
301 0.1
302 0.11
303 0.09
304 0.14
305 0.15