Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VVM3

Protein Details
Accession A0A1Y1VVM3   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
12-31GKISQKIRKKQQVWVRAKKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011330  Glyco_hydro/deAcase_b/a-brl  
IPR002509  NODB_dom  
Gene Ontology GO:0016810  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF01522  Polysacc_deac_1  
PROSITE View protein in PROSITE  
PS51677  NODB  
Amino Acid Sequences MLLSLLMLIIIGKISQKIRKKQQVWVRAKKEGHQIASHTWDHTIPDDDKELEEKMKKLDDLVEANTGYRPKYVRAPLGACNPECVDRFEKIRLQSYSMDTDTHDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.21
3 0.3
4 0.39
5 0.5
6 0.6
7 0.63
8 0.69
9 0.74
10 0.77
11 0.79
12 0.8
13 0.76
14 0.74
15 0.72
16 0.68
17 0.68
18 0.63
19 0.55
20 0.47
21 0.43
22 0.37
23 0.41
24 0.37
25 0.27
26 0.22
27 0.2
28 0.18
29 0.17
30 0.18
31 0.13
32 0.13
33 0.14
34 0.14
35 0.14
36 0.14
37 0.14
38 0.13
39 0.13
40 0.13
41 0.13
42 0.14
43 0.13
44 0.12
45 0.14
46 0.14
47 0.15
48 0.15
49 0.16
50 0.15
51 0.15
52 0.17
53 0.15
54 0.13
55 0.13
56 0.13
57 0.13
58 0.2
59 0.24
60 0.27
61 0.31
62 0.33
63 0.36
64 0.44
65 0.46
66 0.39
67 0.38
68 0.35
69 0.33
70 0.32
71 0.31
72 0.26
73 0.25
74 0.28
75 0.3
76 0.34
77 0.35
78 0.42
79 0.39
80 0.39
81 0.4
82 0.41
83 0.42
84 0.38
85 0.34