Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WZF7

Protein Details
Accession A0A1Y1WZF7    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
111-137ISKIKIERLKSLRKHGKQRKCNVLLSMHydrophilic
NLS Segment(s)
PositionSequence
120-127KSLRKHGK
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, mito 5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF12796  Ank_2  
Amino Acid Sequences MDGWYPFLMAVDKNNVDMIKLLMNKSAKSGVILNIQDKDPLIKTIKNNNVEIVKTLLNYAISNDIFLEINEHKPMTLVINNNVIDIAELLIDYTCKMNLIININEIVIKYISKIKIERLKSLRKHGKQRKCNVLLSMKIDYNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.19
4 0.19
5 0.17
6 0.16
7 0.18
8 0.18
9 0.21
10 0.24
11 0.23
12 0.25
13 0.26
14 0.21
15 0.2
16 0.21
17 0.19
18 0.24
19 0.26
20 0.25
21 0.25
22 0.25
23 0.24
24 0.22
25 0.21
26 0.15
27 0.17
28 0.18
29 0.19
30 0.24
31 0.33
32 0.4
33 0.42
34 0.42
35 0.41
36 0.4
37 0.37
38 0.33
39 0.26
40 0.19
41 0.15
42 0.15
43 0.12
44 0.1
45 0.1
46 0.09
47 0.1
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.08
54 0.11
55 0.08
56 0.1
57 0.1
58 0.1
59 0.09
60 0.09
61 0.1
62 0.09
63 0.11
64 0.11
65 0.12
66 0.18
67 0.18
68 0.18
69 0.17
70 0.15
71 0.12
72 0.1
73 0.09
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.06
85 0.1
86 0.14
87 0.15
88 0.16
89 0.16
90 0.16
91 0.16
92 0.15
93 0.13
94 0.08
95 0.08
96 0.08
97 0.14
98 0.16
99 0.19
100 0.21
101 0.28
102 0.36
103 0.39
104 0.47
105 0.49
106 0.58
107 0.61
108 0.7
109 0.73
110 0.73
111 0.82
112 0.83
113 0.86
114 0.86
115 0.9
116 0.9
117 0.85
118 0.81
119 0.78
120 0.75
121 0.7
122 0.65
123 0.6