Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PHC4

Protein Details
Accession B8PHC4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
15-34SHTLCRRCGNRAFHKQHKECHydrophilic
NLS Segment(s)
PositionSequence
52-75KAKRRKTTGTGRMRYLKHVSRRFK
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ppl:POSPLDRAFT_120321  -  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTTSFGKRHTKSHTLCRRCGNRAFHKQHKECAQCGYPSAKLRSYEWGQKAKRRKTTGTGRMRYLKHVSRRFKNGFRENTTAVKRTKSKPSEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.71
4 0.67
5 0.71
6 0.74
7 0.73
8 0.7
9 0.72
10 0.71
11 0.7
12 0.74
13 0.77
14 0.77
15 0.8
16 0.77
17 0.76
18 0.76
19 0.69
20 0.6
21 0.57
22 0.5
23 0.39
24 0.38
25 0.34
26 0.29
27 0.29
28 0.3
29 0.28
30 0.26
31 0.27
32 0.3
33 0.3
34 0.32
35 0.33
36 0.39
37 0.39
38 0.45
39 0.54
40 0.56
41 0.62
42 0.6
43 0.58
44 0.59
45 0.67
46 0.7
47 0.71
48 0.67
49 0.64
50 0.66
51 0.64
52 0.6
53 0.57
54 0.54
55 0.54
56 0.59
57 0.62
58 0.63
59 0.72
60 0.73
61 0.74
62 0.77
63 0.76
64 0.76
65 0.73
66 0.71
67 0.65
68 0.66
69 0.64
70 0.59
71 0.52
72 0.52
73 0.52
74 0.52
75 0.6