Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PG03

Protein Details
Accession B8PG03    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-50VVSKNHAKPGRRTRSKKEGTVHydrophilic
NLS Segment(s)
PositionSequence
37-45KPGRRTRSK
Subcellular Location(s) mito 22, nucl 4, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021139  NYN  
Gene Ontology GO:0004540  F:RNA nuclease activity  
KEGG ppl:POSPLDRAFT_94384  -  
Pfam View protein in Pfam  
PF01936  NYN  
Amino Acid Sequences MFTTAIKSFASQTPRSVLRLPYPSTPTPAVVSKNHAKPGRRTRSKKEGTVSIFWDMENCGLRLRSKDGYTIEELRRSAEGLGRVKTLKAYLDKSHHATSKSLSAFHSQGFHIVDCPHNGERNVVDRRMRGDKHYKETISILSKRGYNVIVIAPPKALTCMRAAQPAKVLPWRTSLGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.38
4 0.37
5 0.38
6 0.43
7 0.43
8 0.44
9 0.47
10 0.45
11 0.46
12 0.44
13 0.38
14 0.34
15 0.34
16 0.32
17 0.28
18 0.33
19 0.37
20 0.4
21 0.47
22 0.49
23 0.5
24 0.55
25 0.64
26 0.69
27 0.71
28 0.74
29 0.75
30 0.81
31 0.83
32 0.8
33 0.74
34 0.71
35 0.65
36 0.62
37 0.55
38 0.47
39 0.4
40 0.33
41 0.29
42 0.21
43 0.18
44 0.15
45 0.13
46 0.1
47 0.11
48 0.13
49 0.14
50 0.18
51 0.19
52 0.18
53 0.22
54 0.23
55 0.25
56 0.27
57 0.31
58 0.28
59 0.28
60 0.27
61 0.24
62 0.23
63 0.2
64 0.17
65 0.13
66 0.17
67 0.17
68 0.17
69 0.18
70 0.18
71 0.17
72 0.17
73 0.16
74 0.13
75 0.13
76 0.16
77 0.18
78 0.22
79 0.25
80 0.28
81 0.31
82 0.31
83 0.29
84 0.26
85 0.24
86 0.27
87 0.25
88 0.22
89 0.2
90 0.2
91 0.2
92 0.2
93 0.2
94 0.14
95 0.16
96 0.16
97 0.14
98 0.13
99 0.13
100 0.14
101 0.13
102 0.17
103 0.16
104 0.18
105 0.18
106 0.18
107 0.19
108 0.26
109 0.28
110 0.28
111 0.29
112 0.28
113 0.33
114 0.39
115 0.38
116 0.38
117 0.45
118 0.48
119 0.52
120 0.58
121 0.54
122 0.48
123 0.49
124 0.47
125 0.44
126 0.4
127 0.36
128 0.31
129 0.32
130 0.31
131 0.31
132 0.26
133 0.19
134 0.18
135 0.17
136 0.19
137 0.18
138 0.18
139 0.16
140 0.16
141 0.16
142 0.17
143 0.15
144 0.13
145 0.16
146 0.21
147 0.23
148 0.32
149 0.33
150 0.32
151 0.37
152 0.39
153 0.4
154 0.41
155 0.42
156 0.34
157 0.38