Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8P0C0

Protein Details
Accession B8P0C0   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPHKRSKRSLREKQRSASSLNHydrophilic
NLS Segment(s)
PositionSequence
143-148KSAGKK
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR026680  CCDC137  
KEGG ppl:POSPLDRAFT_103488  -  
Amino Acid Sequences MPHKRSKRSLREKQRSASSLNLPPTSTNAIEKEDIPKGAARILYANKIQEEYRDRKRKAQVDGAEPDSQGQGSRKKQRRSEADGDARKSGKVEMKIQPGESMMHFNRRVEDSMRGVVRTAMKHSSTVSRKSRKEEEEALRSAKSAGKKPQPARSQTPEALPATQDSHRASSREHGPKDFERLSTSAPKRLNDIVLAPPDLKKLPRGAKPKAPSTGAGEVASTLRQGALSMAQKAMLEEERVRVVKLYREMKKAKAGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.81
3 0.74
4 0.7
5 0.66
6 0.62
7 0.59
8 0.52
9 0.43
10 0.4
11 0.4
12 0.37
13 0.31
14 0.28
15 0.24
16 0.26
17 0.27
18 0.27
19 0.29
20 0.27
21 0.26
22 0.24
23 0.24
24 0.21
25 0.23
26 0.22
27 0.17
28 0.19
29 0.22
30 0.25
31 0.26
32 0.28
33 0.25
34 0.27
35 0.26
36 0.27
37 0.32
38 0.35
39 0.43
40 0.51
41 0.53
42 0.59
43 0.68
44 0.68
45 0.68
46 0.69
47 0.64
48 0.62
49 0.64
50 0.6
51 0.52
52 0.45
53 0.39
54 0.3
55 0.24
56 0.18
57 0.17
58 0.2
59 0.27
60 0.38
61 0.46
62 0.54
63 0.61
64 0.68
65 0.73
66 0.75
67 0.74
68 0.73
69 0.74
70 0.72
71 0.68
72 0.62
73 0.54
74 0.45
75 0.38
76 0.32
77 0.27
78 0.25
79 0.29
80 0.31
81 0.37
82 0.39
83 0.38
84 0.35
85 0.31
86 0.28
87 0.22
88 0.22
89 0.16
90 0.21
91 0.22
92 0.22
93 0.23
94 0.23
95 0.25
96 0.21
97 0.23
98 0.19
99 0.22
100 0.23
101 0.2
102 0.19
103 0.19
104 0.2
105 0.17
106 0.18
107 0.16
108 0.16
109 0.17
110 0.18
111 0.23
112 0.24
113 0.31
114 0.37
115 0.43
116 0.45
117 0.5
118 0.56
119 0.51
120 0.53
121 0.53
122 0.51
123 0.48
124 0.47
125 0.44
126 0.36
127 0.33
128 0.29
129 0.24
130 0.21
131 0.21
132 0.27
133 0.33
134 0.41
135 0.46
136 0.54
137 0.58
138 0.6
139 0.62
140 0.61
141 0.6
142 0.53
143 0.5
144 0.45
145 0.39
146 0.34
147 0.27
148 0.21
149 0.18
150 0.17
151 0.19
152 0.16
153 0.19
154 0.2
155 0.21
156 0.21
157 0.23
158 0.32
159 0.37
160 0.38
161 0.37
162 0.41
163 0.42
164 0.49
165 0.44
166 0.36
167 0.3
168 0.3
169 0.31
170 0.36
171 0.36
172 0.35
173 0.37
174 0.36
175 0.37
176 0.38
177 0.35
178 0.27
179 0.27
180 0.25
181 0.24
182 0.25
183 0.21
184 0.2
185 0.21
186 0.22
187 0.2
188 0.19
189 0.24
190 0.31
191 0.38
192 0.46
193 0.51
194 0.58
195 0.64
196 0.68
197 0.65
198 0.6
199 0.54
200 0.52
201 0.5
202 0.42
203 0.36
204 0.29
205 0.24
206 0.22
207 0.2
208 0.14
209 0.09
210 0.07
211 0.07
212 0.07
213 0.07
214 0.12
215 0.16
216 0.17
217 0.18
218 0.18
219 0.19
220 0.19
221 0.21
222 0.17
223 0.17
224 0.17
225 0.19
226 0.24
227 0.25
228 0.25
229 0.25
230 0.26
231 0.29
232 0.37
233 0.44
234 0.45
235 0.54
236 0.58
237 0.6