Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1UXP5

Protein Details
Accession A0A1Y1UXP5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
83-102KVSKGKSSDETEKKKRNRTIBasic
NLS Segment(s)
PositionSequence
96-97KK
Subcellular Location(s) nucl 15.5, cyto_nucl 12.333, cyto 8, cyto_mito 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR018631  AAA-ATPase-like_dom  
Pfam View protein in Pfam  
PF09820  AAA-ATPase_like  
Amino Acid Sequences MQKLGVIIDSEDMYKKFKDLLNQEFFVDKSNIINDFNKLIGKDGSCNVCITKPRRFGKTSIAAMLTTYYSVGIDSQEIFDKLKVSKGKSSDETEKKKRNRTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.17
4 0.19
5 0.26
6 0.31
7 0.4
8 0.44
9 0.44
10 0.44
11 0.42
12 0.4
13 0.35
14 0.28
15 0.19
16 0.14
17 0.14
18 0.15
19 0.16
20 0.17
21 0.15
22 0.15
23 0.15
24 0.15
25 0.14
26 0.14
27 0.13
28 0.12
29 0.13
30 0.14
31 0.16
32 0.15
33 0.15
34 0.14
35 0.15
36 0.2
37 0.22
38 0.27
39 0.34
40 0.37
41 0.41
42 0.43
43 0.43
44 0.46
45 0.5
46 0.44
47 0.37
48 0.35
49 0.3
50 0.28
51 0.26
52 0.18
53 0.1
54 0.08
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.07
63 0.09
64 0.1
65 0.11
66 0.11
67 0.13
68 0.13
69 0.2
70 0.23
71 0.26
72 0.31
73 0.34
74 0.4
75 0.43
76 0.5
77 0.54
78 0.59
79 0.65
80 0.7
81 0.76
82 0.78