Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UV91

Protein Details
Accession A0A1Y1UV91   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-71IVYKRISKRDYKEQKKKRLQRKKKINKTNQBasic
NLS Segment(s)
PositionSequence
47-68ISKRDYKEQKKKRLQRKKKINK
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 6.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFYYLLKYKIFLKLFKKFFLFIYFYIISKKNKVFFIYYFDDIVYKRISKRDYKEQKKKRLQRKKKINKTNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.51
4 0.44
5 0.42
6 0.4
7 0.36
8 0.26
9 0.3
10 0.26
11 0.24
12 0.27
13 0.29
14 0.25
15 0.27
16 0.3
17 0.26
18 0.27
19 0.29
20 0.28
21 0.25
22 0.29
23 0.28
24 0.27
25 0.23
26 0.21
27 0.2
28 0.18
29 0.19
30 0.15
31 0.13
32 0.13
33 0.18
34 0.23
35 0.29
36 0.36
37 0.46
38 0.55
39 0.64
40 0.74
41 0.79
42 0.86
43 0.89
44 0.92
45 0.93
46 0.93
47 0.93
48 0.93
49 0.94
50 0.95
51 0.95