Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PHR5

Protein Details
Accession B8PHR5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-31LAVPKKKTSHSRKAMRSANKHydrophilic
NLS Segment(s)
PositionSequence
17-25KKTSHSRKA
Subcellular Location(s) mito 19, nucl 5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ppl:POSPLDRAFT_37595  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences QSLLELFPPFLLAVPKKKTSHSRKAMRSANKGLKDKQNLVHCPGCGSPKLAHHLCPSCYSDLNRTWKSKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.36
3 0.37
4 0.43
5 0.52
6 0.56
7 0.63
8 0.66
9 0.7
10 0.71
11 0.78
12 0.81
13 0.78
14 0.76
15 0.74
16 0.72
17 0.69
18 0.65
19 0.61
20 0.6
21 0.56
22 0.52
23 0.49
24 0.49
25 0.44
26 0.45
27 0.43
28 0.35
29 0.33
30 0.31
31 0.28
32 0.21
33 0.22
34 0.19
35 0.2
36 0.28
37 0.27
38 0.29
39 0.33
40 0.37
41 0.36
42 0.38
43 0.37
44 0.33
45 0.36
46 0.35
47 0.35
48 0.38
49 0.46
50 0.48
51 0.49