Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1VVF7

Protein Details
Accession A0A1Y1VVF7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MNFHYFIAKKKKKKKKKKSKSPFLLRSAALHydrophilic
NLS Segment(s)
PositionSequence
9-21KKKKKKKKKKSKS
Subcellular Location(s) mito 18.5, mito_nucl 13, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MNFHYFIAKKKKKKKKKKSKSPFLLRSAALLNDIMPVVCKRQHILFNKFKTNLSRNVNADNTVGQPCRANADPISDPSGIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.95
4 0.96
5 0.97
6 0.97
7 0.97
8 0.97
9 0.94
10 0.89
11 0.82
12 0.7
13 0.61
14 0.51
15 0.4
16 0.29
17 0.2
18 0.14
19 0.09
20 0.09
21 0.07
22 0.06
23 0.06
24 0.07
25 0.09
26 0.09
27 0.1
28 0.14
29 0.21
30 0.28
31 0.36
32 0.43
33 0.46
34 0.52
35 0.52
36 0.51
37 0.51
38 0.48
39 0.47
40 0.45
41 0.46
42 0.42
43 0.46
44 0.45
45 0.39
46 0.36
47 0.29
48 0.25
49 0.23
50 0.22
51 0.17
52 0.17
53 0.16
54 0.21
55 0.21
56 0.22
57 0.19
58 0.25
59 0.27
60 0.28
61 0.33