Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1X882

Protein Details
Accession A0A1Y1X882    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-89PTKGIFFPLIKNNKKKKIKKIKHydrophilic
NLS Segment(s)
PositionSequence
78-89KNNKKKKIKKIK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences KKEKNRVAQRAWRERKEKYVIELENKIKVLENAKNKSEHEKQQLKLIIEKLRNENTYLKNATSFIFTPTKGIFFPLIKNNKKKKIKKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.74
4 0.66
5 0.6
6 0.59
7 0.54
8 0.54
9 0.57
10 0.5
11 0.46
12 0.43
13 0.38
14 0.3
15 0.27
16 0.27
17 0.26
18 0.33
19 0.33
20 0.35
21 0.37
22 0.38
23 0.43
24 0.44
25 0.45
26 0.45
27 0.48
28 0.46
29 0.5
30 0.53
31 0.46
32 0.43
33 0.4
34 0.37
35 0.32
36 0.35
37 0.33
38 0.33
39 0.33
40 0.32
41 0.35
42 0.32
43 0.34
44 0.34
45 0.29
46 0.26
47 0.26
48 0.24
49 0.21
50 0.19
51 0.17
52 0.18
53 0.18
54 0.2
55 0.2
56 0.21
57 0.17
58 0.19
59 0.18
60 0.17
61 0.22
62 0.29
63 0.38
64 0.45
65 0.56
66 0.64
67 0.71
68 0.8
69 0.85