Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WW97

Protein Details
Accession A0A1Y1WW97    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
107-134SSTMTTKKTYNKKKSTSTTRRSYKRAKKHydrophilic
NLS Segment(s)
PositionSequence
118-134KKKSTSTTRRSYKRAKK
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010666  Znf_GRF  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF06839  zf-GRF  
PROSITE View protein in PROSITE  
PS51999  ZF_GRF  
Amino Acid Sequences MNSPSVNTILKEEFDNMANINNNKPRCKCGLVVIGRIVKSDGPNKGRAYLVCRSKSKNCRYFQWVDEMNIDKSIIQQCMDPNTIYSASSSSTSSSTGYKRKRGSSSSSTMTTKKTYNKKKSTSTTRRSYKRAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.16
4 0.18
5 0.22
6 0.22
7 0.26
8 0.31
9 0.35
10 0.41
11 0.43
12 0.43
13 0.44
14 0.46
15 0.41
16 0.42
17 0.47
18 0.44
19 0.45
20 0.46
21 0.44
22 0.4
23 0.38
24 0.32
25 0.24
26 0.23
27 0.24
28 0.27
29 0.26
30 0.31
31 0.32
32 0.33
33 0.33
34 0.31
35 0.31
36 0.31
37 0.36
38 0.37
39 0.39
40 0.42
41 0.49
42 0.58
43 0.62
44 0.64
45 0.59
46 0.58
47 0.62
48 0.61
49 0.53
50 0.51
51 0.43
52 0.35
53 0.35
54 0.32
55 0.25
56 0.21
57 0.2
58 0.12
59 0.13
60 0.14
61 0.12
62 0.1
63 0.11
64 0.12
65 0.15
66 0.17
67 0.14
68 0.12
69 0.14
70 0.14
71 0.13
72 0.12
73 0.09
74 0.09
75 0.1
76 0.1
77 0.09
78 0.09
79 0.1
80 0.11
81 0.14
82 0.18
83 0.25
84 0.31
85 0.38
86 0.43
87 0.49
88 0.54
89 0.55
90 0.58
91 0.57
92 0.58
93 0.55
94 0.54
95 0.51
96 0.47
97 0.46
98 0.41
99 0.39
100 0.42
101 0.47
102 0.54
103 0.61
104 0.69
105 0.74
106 0.8
107 0.85
108 0.87
109 0.88
110 0.86
111 0.86
112 0.87
113 0.87
114 0.86