Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XEM2

Protein Details
Accession A0A1Y1XEM2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
77-102ESLNIRIINRRKSKKEDKDNVLKRLVHydrophilic
NLS Segment(s)
PositionSequence
88-88K
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MPGLINSRNNSNSSGNISDNTLEERLYTRLVNNIINVNDRTLTVLLNNHTTLIPNINEEHEDISDIIDVLESEDNVESLNIRIINRRKSKKEDKDNVLKRLVIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.28
3 0.26
4 0.26
5 0.23
6 0.21
7 0.22
8 0.17
9 0.13
10 0.12
11 0.14
12 0.14
13 0.14
14 0.14
15 0.12
16 0.16
17 0.18
18 0.18
19 0.18
20 0.2
21 0.19
22 0.21
23 0.21
24 0.18
25 0.16
26 0.15
27 0.15
28 0.12
29 0.11
30 0.08
31 0.1
32 0.11
33 0.12
34 0.12
35 0.11
36 0.11
37 0.11
38 0.11
39 0.11
40 0.1
41 0.09
42 0.09
43 0.09
44 0.1
45 0.1
46 0.11
47 0.08
48 0.09
49 0.08
50 0.07
51 0.07
52 0.06
53 0.06
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.08
67 0.09
68 0.1
69 0.18
70 0.25
71 0.35
72 0.45
73 0.54
74 0.59
75 0.67
76 0.78
77 0.81
78 0.85
79 0.86
80 0.85
81 0.87
82 0.89
83 0.86
84 0.79