Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X5E6

Protein Details
Accession A0A1Y1X5E6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-37DGFIMVGRRKKNNNKIKKVPSKKEKDKNNGFTYKSHydrophilic
NLS Segment(s)
PositionSequence
10-29RRKKNNNKIKKVPSKKEKDK
Subcellular Location(s) nucl 16, cyto_nucl 11.5, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
IPR040044  SRR1L  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MDDGFIMVGRRKKNNNKIKKVPSKKEKDKNNGFTYKSYKTKKTIGTNKNEISVTTIQNRIEEKRLRILESKFYVQLQFDLQIIKPLIQYYRSNEPEYFDVDIVSYGVGNFTKSRISQFQFALCILLKLNLKLNGKVYFYDPVFTDSEKEVIKKYGYEVIEENEHGRRDINKMTLFYMPHCNYNLYNNVLGTNWSLDKLSKLILIGNDFSIYDDIMVSSKFESEAPFLKAILPLTKKVPFPEMFETNDIFNNTTIHFFPKSNILNQTSSFWNMKDKYELKELT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.79
3 0.84
4 0.88
5 0.92
6 0.93
7 0.93
8 0.94
9 0.94
10 0.93
11 0.94
12 0.92
13 0.92
14 0.92
15 0.91
16 0.9
17 0.89
18 0.85
19 0.77
20 0.74
21 0.71
22 0.68
23 0.66
24 0.64
25 0.61
26 0.59
27 0.64
28 0.66
29 0.7
30 0.72
31 0.72
32 0.74
33 0.77
34 0.73
35 0.7
36 0.62
37 0.51
38 0.46
39 0.4
40 0.35
41 0.3
42 0.32
43 0.27
44 0.31
45 0.33
46 0.31
47 0.35
48 0.36
49 0.35
50 0.4
51 0.42
52 0.42
53 0.46
54 0.45
55 0.45
56 0.44
57 0.44
58 0.37
59 0.36
60 0.34
61 0.28
62 0.27
63 0.2
64 0.16
65 0.14
66 0.14
67 0.13
68 0.16
69 0.15
70 0.15
71 0.14
72 0.14
73 0.15
74 0.17
75 0.2
76 0.2
77 0.29
78 0.32
79 0.34
80 0.33
81 0.33
82 0.31
83 0.31
84 0.28
85 0.18
86 0.15
87 0.13
88 0.12
89 0.1
90 0.08
91 0.05
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.06
98 0.08
99 0.09
100 0.12
101 0.17
102 0.2
103 0.23
104 0.24
105 0.25
106 0.24
107 0.23
108 0.22
109 0.16
110 0.14
111 0.1
112 0.12
113 0.11
114 0.1
115 0.14
116 0.18
117 0.19
118 0.2
119 0.22
120 0.22
121 0.22
122 0.22
123 0.21
124 0.19
125 0.17
126 0.17
127 0.15
128 0.15
129 0.15
130 0.14
131 0.14
132 0.11
133 0.13
134 0.13
135 0.13
136 0.11
137 0.12
138 0.13
139 0.11
140 0.12
141 0.16
142 0.16
143 0.16
144 0.16
145 0.16
146 0.17
147 0.17
148 0.17
149 0.14
150 0.14
151 0.12
152 0.13
153 0.13
154 0.15
155 0.18
156 0.21
157 0.21
158 0.21
159 0.23
160 0.25
161 0.24
162 0.23
163 0.29
164 0.25
165 0.25
166 0.25
167 0.25
168 0.23
169 0.26
170 0.28
171 0.21
172 0.21
173 0.19
174 0.18
175 0.17
176 0.17
177 0.13
178 0.12
179 0.09
180 0.09
181 0.09
182 0.09
183 0.1
184 0.1
185 0.1
186 0.09
187 0.09
188 0.11
189 0.12
190 0.14
191 0.13
192 0.13
193 0.13
194 0.12
195 0.12
196 0.11
197 0.09
198 0.07
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.07
207 0.08
208 0.09
209 0.11
210 0.15
211 0.17
212 0.18
213 0.18
214 0.18
215 0.19
216 0.19
217 0.24
218 0.23
219 0.22
220 0.26
221 0.31
222 0.31
223 0.32
224 0.38
225 0.32
226 0.35
227 0.4
228 0.39
229 0.38
230 0.39
231 0.38
232 0.32
233 0.33
234 0.29
235 0.23
236 0.2
237 0.18
238 0.16
239 0.17
240 0.17
241 0.18
242 0.19
243 0.19
244 0.2
245 0.27
246 0.3
247 0.33
248 0.39
249 0.39
250 0.4
251 0.41
252 0.43
253 0.37
254 0.38
255 0.35
256 0.29
257 0.33
258 0.32
259 0.34
260 0.4
261 0.4
262 0.4