Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8P7X7

Protein Details
Accession B8P7X7    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-22INEAKERKEKERQTKAIPIPPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 8.5, golg 4, mito 3, plas 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
KEGG ppl:POSPLDRAFT_94207  -  
Amino Acid Sequences IINEAKERKEKERQTKAIPIPPPRSANPEPPASPVAGPSRPRPDTPVVFRKVDPDWTPDTTQWTWDSSWPNQKHLSGEEWMNVGRNARKEWFDEEEDDGVDWELYGDGEHRSNPKFDLVIHSSLCSSSLGVVVILDFLARSSGRRTVHKPSLVVYESGINIGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.8
4 0.78
5 0.75
6 0.73
7 0.68
8 0.68
9 0.65
10 0.57
11 0.59
12 0.55
13 0.56
14 0.52
15 0.51
16 0.46
17 0.44
18 0.43
19 0.36
20 0.32
21 0.26
22 0.27
23 0.27
24 0.28
25 0.31
26 0.38
27 0.39
28 0.4
29 0.41
30 0.43
31 0.44
32 0.5
33 0.53
34 0.49
35 0.49
36 0.48
37 0.46
38 0.41
39 0.4
40 0.33
41 0.28
42 0.28
43 0.29
44 0.31
45 0.28
46 0.32
47 0.27
48 0.27
49 0.24
50 0.21
51 0.18
52 0.2
53 0.24
54 0.22
55 0.32
56 0.31
57 0.34
58 0.34
59 0.34
60 0.32
61 0.29
62 0.28
63 0.2
64 0.19
65 0.16
66 0.15
67 0.14
68 0.13
69 0.11
70 0.11
71 0.11
72 0.12
73 0.13
74 0.15
75 0.16
76 0.17
77 0.21
78 0.23
79 0.22
80 0.23
81 0.23
82 0.21
83 0.2
84 0.18
85 0.14
86 0.1
87 0.08
88 0.06
89 0.04
90 0.04
91 0.03
92 0.03
93 0.04
94 0.05
95 0.06
96 0.08
97 0.11
98 0.13
99 0.14
100 0.15
101 0.16
102 0.15
103 0.15
104 0.21
105 0.22
106 0.24
107 0.24
108 0.23
109 0.22
110 0.21
111 0.21
112 0.14
113 0.1
114 0.07
115 0.07
116 0.07
117 0.07
118 0.06
119 0.06
120 0.05
121 0.05
122 0.04
123 0.03
124 0.03
125 0.05
126 0.06
127 0.07
128 0.1
129 0.17
130 0.21
131 0.28
132 0.34
133 0.42
134 0.51
135 0.55
136 0.52
137 0.49
138 0.54
139 0.49
140 0.44
141 0.36
142 0.3
143 0.25