Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1UES3

Protein Details
Accession A0A1Y1UES3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-127IEPRMEQKKELKKDQKKELKKEQKKELKKEQKKELKKEQKKELKKEQKKELKKEQKKELKKEQKKGQKKEQKKEQKNDQKKDQKNDQKNEIEKQBasic
NLS Segment(s)
PositionSequence
35-113EPRMEQKKELKKDQKKELKKEQKKELKKEQKKELKKEQKKELKKEQKKELKKEQKKELKKEQKKGQKKEQKKEQKNDQK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.833, mito 2, cyto 2
Family & Domain DBs
Amino Acid Sequences KPENKIKEIESQHKMIKENKIDQNKEQNKEKPEIEPRMEQKKELKKDQKKELKKEQKKELKKEQKKELKKEQKKELKKEQKKELKKEQKKELKKEQKKGQKKEQKKEQKNDQKKDQKNDQKNEIEKQIQIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.53
4 0.52
5 0.56
6 0.6
7 0.65
8 0.65
9 0.67
10 0.72
11 0.71
12 0.7
13 0.69
14 0.67
15 0.62
16 0.63
17 0.58
18 0.55
19 0.55
20 0.56
21 0.51
22 0.52
23 0.54
24 0.59
25 0.58
26 0.53
27 0.53
28 0.55
29 0.58
30 0.61
31 0.65
32 0.65
33 0.73
34 0.8
35 0.82
36 0.81
37 0.83
38 0.84
39 0.85
40 0.84
41 0.84
42 0.84
43 0.84
44 0.83
45 0.83
46 0.83
47 0.83
48 0.83
49 0.83
50 0.83
51 0.83
52 0.83
53 0.83
54 0.83
55 0.83
56 0.83
57 0.83
58 0.83
59 0.83
60 0.83
61 0.83
62 0.83
63 0.83
64 0.83
65 0.83
66 0.83
67 0.83
68 0.83
69 0.83
70 0.83
71 0.83
72 0.83
73 0.83
74 0.83
75 0.83
76 0.83
77 0.83
78 0.83
79 0.83
80 0.83
81 0.85
82 0.85
83 0.85
84 0.87
85 0.88
86 0.88
87 0.87
88 0.88
89 0.89
90 0.9
91 0.91
92 0.91
93 0.92
94 0.92
95 0.92
96 0.93
97 0.91
98 0.91
99 0.9
100 0.89
101 0.88
102 0.88
103 0.88
104 0.87
105 0.86
106 0.85
107 0.84
108 0.81
109 0.78
110 0.75
111 0.68