Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X0Y4

Protein Details
Accession A0A1Y1X0Y4    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MDKKLEKKEDIKNKKSNNNSVDHydrophilic
106-132LHNNNNNTKDKNKKKKNKNFINWSYVWHydrophilic
NLS Segment(s)
PositionSequence
117-121NKKKK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039690  SNRNP25  
IPR040610  SNRNP25_ubiquitin  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0005689  C:U12-type spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF18036  Ubiquitin_4  
Amino Acid Sequences MDKKLEKKEDIKNKKSNNNSVDYKKCKEELYEILNQLKKDTLLKDIKEENFNLEYINLLYKYETGNAYKIIVERGDLPPIEILIKTNATLLDLKHQFVKQLNNLYLHNNNNNTKDKNKKKKNKNFINWSYVWKRYCFSYNGTRLTNDKLNLKDAGFKKNTTLQFKKYLYNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.84
4 0.79
5 0.76
6 0.74
7 0.74
8 0.74
9 0.72
10 0.67
11 0.63
12 0.59
13 0.53
14 0.48
15 0.45
16 0.42
17 0.41
18 0.43
19 0.41
20 0.44
21 0.46
22 0.43
23 0.37
24 0.32
25 0.27
26 0.24
27 0.22
28 0.25
29 0.28
30 0.29
31 0.33
32 0.38
33 0.4
34 0.4
35 0.39
36 0.35
37 0.29
38 0.28
39 0.24
40 0.17
41 0.14
42 0.11
43 0.13
44 0.09
45 0.08
46 0.08
47 0.08
48 0.09
49 0.1
50 0.12
51 0.11
52 0.12
53 0.12
54 0.13
55 0.13
56 0.13
57 0.12
58 0.1
59 0.09
60 0.11
61 0.11
62 0.13
63 0.12
64 0.12
65 0.1
66 0.11
67 0.11
68 0.08
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.14
79 0.15
80 0.15
81 0.18
82 0.18
83 0.19
84 0.21
85 0.25
86 0.22
87 0.27
88 0.29
89 0.29
90 0.29
91 0.31
92 0.33
93 0.31
94 0.32
95 0.31
96 0.32
97 0.35
98 0.4
99 0.39
100 0.41
101 0.49
102 0.55
103 0.61
104 0.69
105 0.74
106 0.8
107 0.88
108 0.93
109 0.93
110 0.93
111 0.93
112 0.88
113 0.86
114 0.76
115 0.73
116 0.68
117 0.63
118 0.55
119 0.45
120 0.39
121 0.35
122 0.38
123 0.32
124 0.32
125 0.36
126 0.41
127 0.45
128 0.46
129 0.44
130 0.42
131 0.45
132 0.45
133 0.39
134 0.38
135 0.34
136 0.36
137 0.36
138 0.35
139 0.38
140 0.35
141 0.42
142 0.38
143 0.37
144 0.38
145 0.44
146 0.51
147 0.52
148 0.56
149 0.52
150 0.59
151 0.61
152 0.64