Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XMT6

Protein Details
Accession A0A1Y1XMT6    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-76DSEDEKPKPSPKPKESPKVNPKQKTTKKLTKAQQRKAEEHydrophilic
207-236QLQITNKQKAQAKKKKTPKKASIKQAYDDDHydrophilic
NLS Segment(s)
PositionSequence
43-83KPKPSPKPKESPKVNPKQKTTKKLTKAQQRKAEEEKRMREK
215-227KAQAKKKKTPKKA
Subcellular Location(s) nucl 15, cyto 8.5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023194  eIF3-like_dom_sf  
IPR013906  eIF3j  
Gene Ontology GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF08597  eIF3_subunit  
Amino Acid Sequences MDDWENEDFDNVKLPGVKNRWDDEDVDSEEDIKESWDDSEDEKPKPSPKPKESPKVNPKQKTTKKLTKAQQRKAEEEKRMREKEEREELENETIDQRKLREAKLVQESDFQNALDLFGADAAIPRNKDDDEDYSDDDVENEKEKKVFIEELKPKTKEDFKKYAETVYEEISRYDKNQFYNYLLETLLKNVSEPMEIANVRKLINTLQLQITNKQKAQAKKKKTPKKASIKQAYDDDIISDGMKFKYDDGADDYDFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.29
3 0.33
4 0.4
5 0.4
6 0.44
7 0.48
8 0.46
9 0.46
10 0.42
11 0.43
12 0.38
13 0.35
14 0.31
15 0.26
16 0.24
17 0.22
18 0.17
19 0.12
20 0.09
21 0.08
22 0.08
23 0.09
24 0.11
25 0.13
26 0.22
27 0.25
28 0.27
29 0.29
30 0.32
31 0.37
32 0.45
33 0.52
34 0.54
35 0.59
36 0.68
37 0.75
38 0.82
39 0.84
40 0.86
41 0.87
42 0.88
43 0.89
44 0.86
45 0.84
46 0.85
47 0.85
48 0.84
49 0.83
50 0.82
51 0.8
52 0.81
53 0.82
54 0.82
55 0.83
56 0.83
57 0.83
58 0.78
59 0.76
60 0.77
61 0.76
62 0.75
63 0.73
64 0.72
65 0.73
66 0.7
67 0.67
68 0.64
69 0.6
70 0.6
71 0.61
72 0.54
73 0.48
74 0.47
75 0.46
76 0.42
77 0.37
78 0.29
79 0.22
80 0.2
81 0.17
82 0.16
83 0.15
84 0.18
85 0.21
86 0.21
87 0.26
88 0.26
89 0.32
90 0.39
91 0.4
92 0.34
93 0.37
94 0.36
95 0.31
96 0.31
97 0.24
98 0.16
99 0.14
100 0.13
101 0.08
102 0.07
103 0.04
104 0.04
105 0.04
106 0.03
107 0.04
108 0.05
109 0.06
110 0.07
111 0.07
112 0.08
113 0.08
114 0.09
115 0.11
116 0.13
117 0.16
118 0.18
119 0.19
120 0.18
121 0.18
122 0.17
123 0.16
124 0.14
125 0.1
126 0.11
127 0.1
128 0.1
129 0.11
130 0.11
131 0.11
132 0.12
133 0.15
134 0.15
135 0.24
136 0.31
137 0.37
138 0.44
139 0.45
140 0.43
141 0.44
142 0.5
143 0.49
144 0.49
145 0.52
146 0.49
147 0.55
148 0.55
149 0.53
150 0.46
151 0.41
152 0.34
153 0.28
154 0.27
155 0.2
156 0.2
157 0.19
158 0.18
159 0.17
160 0.21
161 0.21
162 0.21
163 0.24
164 0.25
165 0.26
166 0.28
167 0.27
168 0.23
169 0.2
170 0.19
171 0.16
172 0.16
173 0.15
174 0.11
175 0.11
176 0.1
177 0.11
178 0.1
179 0.1
180 0.09
181 0.13
182 0.13
183 0.14
184 0.17
185 0.18
186 0.18
187 0.18
188 0.18
189 0.15
190 0.22
191 0.23
192 0.22
193 0.23
194 0.28
195 0.3
196 0.35
197 0.42
198 0.4
199 0.39
200 0.42
201 0.45
202 0.5
203 0.59
204 0.64
205 0.66
206 0.7
207 0.8
208 0.85
209 0.9
210 0.92
211 0.91
212 0.92
213 0.92
214 0.92
215 0.92
216 0.87
217 0.82
218 0.76
219 0.69
220 0.59
221 0.5
222 0.4
223 0.3
224 0.25
225 0.19
226 0.15
227 0.13
228 0.12
229 0.14
230 0.13
231 0.13
232 0.19
233 0.19
234 0.21
235 0.23
236 0.27