Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8PQ13

Protein Details
Accession B8PQ13   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
79-98SGSSGKPKRKRAKVEDMDVDHydrophilic
109-129DDETRPAKAKKGRKNKALTDEBasic
NLS Segment(s)
PositionSequence
84-90KPKRKRA
114-124PAKAKKGRKNK
Subcellular Location(s) cyto_nucl 15, nucl 14.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014876  DEK_C  
KEGG ppl:POSPLDRAFT_104037  -  
PROSITE View protein in PROSITE  
PS51998  DEK_C  
Amino Acid Sequences MSINLDALEPQIREILTAPGIDLSTISARRVRKQLLEVDTSLTADSLKENREKIDELIANIYEQVSAEASRGGSDEGESGSSGKPKRKRAKVEDMDVDDGEEEGEEEDDDETRPAKAKKGRKNKALTDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.13
5 0.12
6 0.11
7 0.11
8 0.1
9 0.09
10 0.08
11 0.11
12 0.12
13 0.13
14 0.17
15 0.19
16 0.25
17 0.31
18 0.33
19 0.33
20 0.37
21 0.44
22 0.43
23 0.44
24 0.4
25 0.36
26 0.33
27 0.29
28 0.24
29 0.16
30 0.11
31 0.08
32 0.09
33 0.09
34 0.11
35 0.13
36 0.14
37 0.15
38 0.18
39 0.19
40 0.18
41 0.22
42 0.2
43 0.18
44 0.18
45 0.17
46 0.15
47 0.14
48 0.13
49 0.06
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.07
68 0.11
69 0.14
70 0.21
71 0.28
72 0.38
73 0.48
74 0.56
75 0.66
76 0.7
77 0.79
78 0.79
79 0.8
80 0.77
81 0.71
82 0.65
83 0.55
84 0.46
85 0.34
86 0.26
87 0.19
88 0.11
89 0.07
90 0.04
91 0.05
92 0.04
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.08
99 0.08
100 0.14
101 0.15
102 0.23
103 0.31
104 0.41
105 0.5
106 0.61
107 0.71
108 0.75
109 0.83