Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PPW0

Protein Details
Accession B8PPW0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
246-268EIARRASKAERRRISKQTRSDVVHydrophilic
NLS Segment(s)
PositionSequence
256-256R
Subcellular Location(s) mito 15, nucl 7, pero 2, cyto 1, plas 1, extr 1
Family & Domain DBs
KEGG ppl:POSPLDRAFT_96626  -  
Amino Acid Sequences MAFPTAFPMAFPTAFPRVFPSGIPYLVFPTQQVDTKPPNPSTQVIRVSHSSLQQDRSTLNRLTLKKNAALKAKQHSEVPVHQRRRWNAEAKAATAVENRQRPPKVNHKAKKILHGNVRCNWHKNHFQQQNKVVIMGKRTPKVRCCQNVCIKRRNRLIAARDLAHCLTVASFNVGRKTTDRQKWSHWDCLKPGQLFFHQRVDNAGTIHVSALGGFAQLPVTQQNVVTAAIEAAVPGAAPPALGSAAEIARRASKAERRRISKQTRSDVVSLHACLAKAHRILGKKNFVSDSIQLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.27
4 0.28
5 0.28
6 0.28
7 0.28
8 0.26
9 0.27
10 0.27
11 0.23
12 0.23
13 0.24
14 0.24
15 0.18
16 0.18
17 0.19
18 0.22
19 0.23
20 0.25
21 0.31
22 0.36
23 0.43
24 0.42
25 0.44
26 0.44
27 0.46
28 0.46
29 0.47
30 0.49
31 0.44
32 0.45
33 0.43
34 0.44
35 0.43
36 0.41
37 0.39
38 0.35
39 0.38
40 0.35
41 0.34
42 0.32
43 0.33
44 0.34
45 0.28
46 0.3
47 0.33
48 0.36
49 0.4
50 0.45
51 0.44
52 0.45
53 0.5
54 0.51
55 0.51
56 0.52
57 0.53
58 0.55
59 0.57
60 0.53
61 0.48
62 0.46
63 0.43
64 0.45
65 0.49
66 0.5
67 0.52
68 0.54
69 0.6
70 0.61
71 0.64
72 0.63
73 0.61
74 0.55
75 0.57
76 0.55
77 0.49
78 0.47
79 0.39
80 0.33
81 0.27
82 0.27
83 0.24
84 0.27
85 0.28
86 0.32
87 0.34
88 0.37
89 0.43
90 0.5
91 0.54
92 0.6
93 0.66
94 0.67
95 0.75
96 0.73
97 0.76
98 0.72
99 0.68
100 0.67
101 0.67
102 0.63
103 0.59
104 0.63
105 0.56
106 0.53
107 0.49
108 0.46
109 0.47
110 0.48
111 0.53
112 0.55
113 0.58
114 0.62
115 0.64
116 0.65
117 0.56
118 0.51
119 0.43
120 0.36
121 0.33
122 0.31
123 0.3
124 0.28
125 0.32
126 0.34
127 0.36
128 0.41
129 0.46
130 0.49
131 0.51
132 0.55
133 0.61
134 0.67
135 0.68
136 0.71
137 0.67
138 0.67
139 0.67
140 0.62
141 0.57
142 0.55
143 0.53
144 0.51
145 0.49
146 0.43
147 0.38
148 0.36
149 0.31
150 0.24
151 0.19
152 0.12
153 0.09
154 0.08
155 0.07
156 0.07
157 0.09
158 0.1
159 0.13
160 0.14
161 0.14
162 0.16
163 0.23
164 0.3
165 0.35
166 0.39
167 0.4
168 0.46
169 0.55
170 0.58
171 0.61
172 0.57
173 0.53
174 0.52
175 0.56
176 0.56
177 0.47
178 0.43
179 0.36
180 0.37
181 0.38
182 0.37
183 0.37
184 0.32
185 0.3
186 0.32
187 0.31
188 0.27
189 0.23
190 0.2
191 0.13
192 0.13
193 0.12
194 0.1
195 0.07
196 0.05
197 0.05
198 0.05
199 0.04
200 0.04
201 0.04
202 0.05
203 0.05
204 0.06
205 0.06
206 0.08
207 0.08
208 0.08
209 0.09
210 0.1
211 0.1
212 0.1
213 0.09
214 0.07
215 0.07
216 0.07
217 0.06
218 0.04
219 0.04
220 0.03
221 0.03
222 0.04
223 0.03
224 0.03
225 0.03
226 0.04
227 0.05
228 0.05
229 0.05
230 0.07
231 0.09
232 0.1
233 0.1
234 0.11
235 0.13
236 0.14
237 0.16
238 0.21
239 0.29
240 0.38
241 0.48
242 0.56
243 0.61
244 0.69
245 0.78
246 0.81
247 0.82
248 0.82
249 0.8
250 0.78
251 0.75
252 0.69
253 0.6
254 0.54
255 0.49
256 0.4
257 0.34
258 0.29
259 0.24
260 0.23
261 0.25
262 0.27
263 0.23
264 0.27
265 0.29
266 0.33
267 0.41
268 0.49
269 0.56
270 0.52
271 0.56
272 0.54
273 0.51
274 0.5