Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XQB3

Protein Details
Accession A0A1Y1XQB3   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-25LIGFTCKKCNKRSYKLISKKSYYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024158  Mt_import_TIM15  
IPR007853  Znf_DNL-typ  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05180  zf-DNL  
PROSITE View protein in PROSITE  
PS51501  ZF_DNL  
Amino Acid Sequences KFLIGFTCKKCNKRSYKLISKKSYYEGVVIIRCDQCKNLHLIADHLGWYDSMNKFGTIEDYFKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.82
4 0.85
5 0.88
6 0.85
7 0.79
8 0.73
9 0.66
10 0.59
11 0.48
12 0.39
13 0.31
14 0.26
15 0.23
16 0.2
17 0.19
18 0.17
19 0.17
20 0.16
21 0.16
22 0.15
23 0.15
24 0.19
25 0.17
26 0.18
27 0.17
28 0.19
29 0.2
30 0.19
31 0.17
32 0.13
33 0.12
34 0.1
35 0.1
36 0.14
37 0.12
38 0.14
39 0.15
40 0.15
41 0.15
42 0.16
43 0.19
44 0.16
45 0.2