Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WUR2

Protein Details
Accession A0A1Y1WUR2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-69TKNNEPLKPKEKKVKYLKEPRVVHLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013641  KTI12/PSTK  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
Pfam View protein in Pfam  
PF08433  KTI12  
Amino Acid Sequences MPLIIVCGLPCSGKTKRAEELKKIMETYAPSEKEENDKKNSTDNTKNNEPLKPKEKKVKYLKEPRVVHLLNEDGFGLDRVKTYSTIAEEKKARSMLMSSVERLLNKDTVVIADAMNYIKGFRYQLYCVAKSLRTPHCIVHAAIPIDKAREWHKNRKEEEKYDPNMFENLITRFEEPDSRNRWDSPLFTLLPEDNIEDFAQNIVDALILRKAPPPNLSTISKKPQETNYLYKLDKITQTITNIVVEAQKNGSFGETKVPNCDKKLNVPSRSVTLSELRKLKRQFININKTFTSLSLNKVAELFTDYLNDNLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.43
4 0.53
5 0.6
6 0.62
7 0.68
8 0.68
9 0.66
10 0.62
11 0.55
12 0.48
13 0.42
14 0.39
15 0.39
16 0.33
17 0.31
18 0.32
19 0.34
20 0.4
21 0.46
22 0.47
23 0.45
24 0.48
25 0.47
26 0.54
27 0.58
28 0.56
29 0.58
30 0.6
31 0.6
32 0.64
33 0.69
34 0.66
35 0.65
36 0.63
37 0.62
38 0.64
39 0.64
40 0.64
41 0.68
42 0.71
43 0.75
44 0.8
45 0.81
46 0.82
47 0.85
48 0.87
49 0.86
50 0.83
51 0.76
52 0.74
53 0.64
54 0.54
55 0.47
56 0.4
57 0.3
58 0.27
59 0.24
60 0.14
61 0.14
62 0.14
63 0.11
64 0.08
65 0.08
66 0.09
67 0.1
68 0.1
69 0.11
70 0.13
71 0.15
72 0.22
73 0.23
74 0.28
75 0.31
76 0.31
77 0.35
78 0.33
79 0.29
80 0.23
81 0.23
82 0.2
83 0.23
84 0.23
85 0.2
86 0.22
87 0.24
88 0.23
89 0.23
90 0.23
91 0.16
92 0.15
93 0.15
94 0.12
95 0.1
96 0.11
97 0.1
98 0.07
99 0.07
100 0.08
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.07
107 0.07
108 0.08
109 0.11
110 0.12
111 0.2
112 0.25
113 0.25
114 0.25
115 0.27
116 0.26
117 0.25
118 0.32
119 0.29
120 0.28
121 0.28
122 0.28
123 0.3
124 0.32
125 0.3
126 0.26
127 0.24
128 0.21
129 0.2
130 0.21
131 0.17
132 0.15
133 0.15
134 0.13
135 0.14
136 0.23
137 0.29
138 0.38
139 0.45
140 0.53
141 0.56
142 0.65
143 0.67
144 0.62
145 0.64
146 0.63
147 0.59
148 0.53
149 0.51
150 0.41
151 0.36
152 0.31
153 0.23
154 0.16
155 0.14
156 0.13
157 0.13
158 0.12
159 0.12
160 0.13
161 0.18
162 0.17
163 0.23
164 0.27
165 0.29
166 0.31
167 0.31
168 0.32
169 0.29
170 0.29
171 0.25
172 0.25
173 0.21
174 0.2
175 0.21
176 0.18
177 0.17
178 0.16
179 0.13
180 0.09
181 0.1
182 0.1
183 0.08
184 0.08
185 0.07
186 0.07
187 0.05
188 0.05
189 0.04
190 0.04
191 0.04
192 0.05
193 0.06
194 0.06
195 0.08
196 0.12
197 0.14
198 0.16
199 0.19
200 0.2
201 0.23
202 0.28
203 0.31
204 0.33
205 0.38
206 0.44
207 0.46
208 0.47
209 0.46
210 0.46
211 0.51
212 0.51
213 0.51
214 0.49
215 0.49
216 0.47
217 0.47
218 0.43
219 0.39
220 0.35
221 0.31
222 0.28
223 0.26
224 0.28
225 0.27
226 0.26
227 0.22
228 0.19
229 0.17
230 0.18
231 0.15
232 0.15
233 0.15
234 0.15
235 0.15
236 0.15
237 0.16
238 0.13
239 0.13
240 0.2
241 0.22
242 0.22
243 0.3
244 0.36
245 0.39
246 0.42
247 0.48
248 0.42
249 0.47
250 0.57
251 0.59
252 0.57
253 0.58
254 0.57
255 0.55
256 0.54
257 0.46
258 0.38
259 0.36
260 0.37
261 0.39
262 0.44
263 0.43
264 0.49
265 0.51
266 0.57
267 0.57
268 0.61
269 0.64
270 0.67
271 0.75
272 0.72
273 0.75
274 0.66
275 0.61
276 0.53
277 0.43
278 0.4
279 0.31
280 0.3
281 0.32
282 0.32
283 0.3
284 0.3
285 0.29
286 0.22
287 0.24
288 0.21
289 0.14
290 0.16
291 0.16