Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WVB9

Protein Details
Accession A0A1Y1WVB9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
108-133SAILKSKKPAKTIKKREQKGVRKVRAHydrophilic
NLS Segment(s)
PositionSequence
104-133AARVSAILKSKKPAKTIKKREQKGVRKVRA
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSADLVWQIVKNNNSFLVKKCGAQFSSEPGNLMNVNSFKYSGIANNKAVIIGSTEKGVSVATTKASTKNLKTAAVELKKGARPSAVAVKNILKGYRPDLSKAAAARVSAILKSKKPAKTIKKREQKGVRKVRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.33
4 0.36
5 0.34
6 0.36
7 0.38
8 0.39
9 0.36
10 0.38
11 0.35
12 0.32
13 0.38
14 0.35
15 0.31
16 0.25
17 0.26
18 0.22
19 0.21
20 0.19
21 0.12
22 0.14
23 0.14
24 0.14
25 0.12
26 0.13
27 0.13
28 0.15
29 0.2
30 0.23
31 0.23
32 0.24
33 0.23
34 0.23
35 0.22
36 0.16
37 0.12
38 0.1
39 0.09
40 0.09
41 0.08
42 0.08
43 0.09
44 0.08
45 0.06
46 0.05
47 0.06
48 0.06
49 0.07
50 0.08
51 0.1
52 0.14
53 0.17
54 0.17
55 0.21
56 0.22
57 0.23
58 0.22
59 0.24
60 0.28
61 0.28
62 0.28
63 0.23
64 0.26
65 0.27
66 0.27
67 0.24
68 0.16
69 0.15
70 0.17
71 0.26
72 0.24
73 0.23
74 0.25
75 0.27
76 0.3
77 0.31
78 0.28
79 0.2
80 0.19
81 0.22
82 0.26
83 0.25
84 0.24
85 0.24
86 0.26
87 0.28
88 0.27
89 0.26
90 0.22
91 0.2
92 0.19
93 0.19
94 0.19
95 0.17
96 0.22
97 0.23
98 0.24
99 0.31
100 0.37
101 0.4
102 0.46
103 0.55
104 0.6
105 0.67
106 0.76
107 0.8
108 0.83
109 0.85
110 0.89
111 0.89
112 0.89
113 0.88