Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WY44

Protein Details
Accession A0A1Y1WY44   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
415-439KTVVDISKKKSKKSKDNNENENENIHydrophilic
NLS Segment(s)
PositionSequence
423-427KKSKK
Subcellular Location(s) plas 10, mito 6, E.R. 5, golg 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001991  Na-dicarboxylate_symporter  
IPR036458  Na:dicarbo_symporter_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0015293  F:symporter activity  
Pfam View protein in Pfam  
PF00375  SDF  
Amino Acid Sequences MNVKEIISIFHHVNLVIKIIIGLIIGAVLGVFFKDLPIIPLIGDMFVDVLKSVAPILVFTLVISSLTQGNSKLDKRFTLILVLYFISTFLSSLLTVIVDYIYPISVKLAEEYKAENVPTSMQEVIKNLFLNMVGNPVGALRDAEYICILFWAILIGIGAKTIASDTTKKLIEDISNIVLEIINWIIVASPYGILGLVYTSVSTNGISIFTDYGKLIIVLVLCMLITGLIINPIIVAIVLRRNPYPLIFICLKESGITAFFTRSSAANIPINLKLSEKLGLDKEIYSVSIPFGATVNMQGAAITIAVMALAAANTVKIEVSFISATVLLFVATLGACGSSGVANGCLFMIPMACSLLGCSDEVSMQIVGIGFIVAVVQDAFCTALNSSSDVVFTATAEYLKWKKEGKSLPTFLGGKTVVDISKKKSKKSKDNNENENENIVIKIESNTDLLKKVSNIEEKDELW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.16
4 0.15
5 0.12
6 0.11
7 0.11
8 0.07
9 0.06
10 0.04
11 0.04
12 0.03
13 0.03
14 0.03
15 0.02
16 0.02
17 0.03
18 0.03
19 0.03
20 0.04
21 0.06
22 0.06
23 0.08
24 0.1
25 0.1
26 0.1
27 0.12
28 0.12
29 0.11
30 0.1
31 0.08
32 0.07
33 0.07
34 0.07
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.07
44 0.08
45 0.08
46 0.08
47 0.08
48 0.07
49 0.08
50 0.08
51 0.08
52 0.09
53 0.1
54 0.11
55 0.12
56 0.15
57 0.22
58 0.26
59 0.3
60 0.31
61 0.32
62 0.35
63 0.37
64 0.34
65 0.33
66 0.3
67 0.25
68 0.24
69 0.23
70 0.19
71 0.15
72 0.14
73 0.1
74 0.08
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.04
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.06
92 0.07
93 0.07
94 0.09
95 0.11
96 0.12
97 0.14
98 0.16
99 0.18
100 0.18
101 0.18
102 0.16
103 0.15
104 0.15
105 0.15
106 0.15
107 0.14
108 0.13
109 0.15
110 0.16
111 0.17
112 0.18
113 0.17
114 0.15
115 0.14
116 0.12
117 0.12
118 0.1
119 0.11
120 0.09
121 0.08
122 0.08
123 0.08
124 0.08
125 0.07
126 0.07
127 0.05
128 0.09
129 0.09
130 0.1
131 0.1
132 0.1
133 0.09
134 0.09
135 0.08
136 0.04
137 0.04
138 0.04
139 0.03
140 0.03
141 0.03
142 0.04
143 0.03
144 0.04
145 0.04
146 0.03
147 0.03
148 0.03
149 0.04
150 0.06
151 0.08
152 0.1
153 0.15
154 0.16
155 0.16
156 0.17
157 0.18
158 0.17
159 0.17
160 0.18
161 0.15
162 0.14
163 0.14
164 0.14
165 0.11
166 0.1
167 0.08
168 0.06
169 0.04
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.04
188 0.04
189 0.04
190 0.05
191 0.04
192 0.05
193 0.05
194 0.05
195 0.06
196 0.05
197 0.06
198 0.06
199 0.06
200 0.06
201 0.06
202 0.05
203 0.05
204 0.05
205 0.04
206 0.04
207 0.04
208 0.03
209 0.03
210 0.03
211 0.02
212 0.02
213 0.02
214 0.02
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.02
222 0.02
223 0.03
224 0.06
225 0.08
226 0.09
227 0.09
228 0.11
229 0.11
230 0.12
231 0.15
232 0.12
233 0.15
234 0.16
235 0.16
236 0.17
237 0.17
238 0.17
239 0.13
240 0.13
241 0.09
242 0.09
243 0.09
244 0.07
245 0.07
246 0.08
247 0.08
248 0.09
249 0.08
250 0.1
251 0.11
252 0.13
253 0.14
254 0.15
255 0.16
256 0.17
257 0.18
258 0.16
259 0.16
260 0.14
261 0.13
262 0.15
263 0.13
264 0.14
265 0.14
266 0.15
267 0.15
268 0.14
269 0.14
270 0.12
271 0.12
272 0.09
273 0.09
274 0.07
275 0.08
276 0.07
277 0.07
278 0.07
279 0.07
280 0.07
281 0.07
282 0.07
283 0.06
284 0.06
285 0.06
286 0.05
287 0.05
288 0.05
289 0.04
290 0.03
291 0.03
292 0.03
293 0.03
294 0.02
295 0.02
296 0.02
297 0.02
298 0.02
299 0.02
300 0.03
301 0.03
302 0.03
303 0.03
304 0.04
305 0.04
306 0.07
307 0.07
308 0.07
309 0.08
310 0.08
311 0.08
312 0.08
313 0.08
314 0.05
315 0.05
316 0.05
317 0.04
318 0.04
319 0.04
320 0.04
321 0.03
322 0.03
323 0.03
324 0.04
325 0.04
326 0.04
327 0.05
328 0.06
329 0.06
330 0.06
331 0.06
332 0.06
333 0.06
334 0.05
335 0.06
336 0.05
337 0.06
338 0.06
339 0.06
340 0.06
341 0.06
342 0.07
343 0.07
344 0.07
345 0.07
346 0.07
347 0.07
348 0.07
349 0.09
350 0.08
351 0.07
352 0.07
353 0.07
354 0.06
355 0.06
356 0.06
357 0.04
358 0.03
359 0.04
360 0.03
361 0.03
362 0.03
363 0.03
364 0.03
365 0.03
366 0.05
367 0.05
368 0.06
369 0.06
370 0.09
371 0.09
372 0.11
373 0.12
374 0.12
375 0.12
376 0.11
377 0.12
378 0.09
379 0.09
380 0.09
381 0.08
382 0.08
383 0.08
384 0.14
385 0.17
386 0.2
387 0.24
388 0.28
389 0.31
390 0.4
391 0.48
392 0.51
393 0.57
394 0.59
395 0.57
396 0.59
397 0.57
398 0.48
399 0.45
400 0.37
401 0.27
402 0.24
403 0.24
404 0.19
405 0.24
406 0.27
407 0.28
408 0.38
409 0.42
410 0.49
411 0.56
412 0.65
413 0.71
414 0.79
415 0.83
416 0.84
417 0.9
418 0.92
419 0.91
420 0.85
421 0.76
422 0.67
423 0.57
424 0.46
425 0.36
426 0.26
427 0.18
428 0.14
429 0.14
430 0.13
431 0.14
432 0.15
433 0.17
434 0.19
435 0.21
436 0.21
437 0.23
438 0.22
439 0.25
440 0.31
441 0.37
442 0.38
443 0.41