Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XD52

Protein Details
Accession A0A1Y1XD52    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-59MNSRSHRKKILLKKYKFDCHCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
Pfam View protein in Pfam  
PF00856  SET  
PROSITE View protein in PROSITE  
PS50280  SET  
CDD cd20071  SET_SMYD  
Amino Acid Sequences NHSCSPNATLYYHGNRQILRAMRDIQKGEEICITYTDVMNSRSHRKKILLKKYKFDCHCERC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.35
4 0.38
5 0.36
6 0.33
7 0.31
8 0.31
9 0.34
10 0.38
11 0.37
12 0.31
13 0.32
14 0.29
15 0.27
16 0.24
17 0.19
18 0.15
19 0.15
20 0.14
21 0.09
22 0.09
23 0.09
24 0.09
25 0.11
26 0.13
27 0.16
28 0.25
29 0.32
30 0.34
31 0.38
32 0.43
33 0.51
34 0.59
35 0.67
36 0.68
37 0.68
38 0.75
39 0.8
40 0.84
41 0.79
42 0.76