Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XBJ7

Protein Details
Accession A0A1Y1XBJ7   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSDIKSNKPKNNAIRQQRLKAWQPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, nucl 7, E.R. 3, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005045  CDC50/LEM3_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0045332  P:phospholipid translocation  
Pfam View protein in Pfam  
PF03381  CDC50  
Amino Acid Sequences MSDIKSNKPKNNAIRQQRLKAWQPILTPKSVLPTLFFIGISFIPVGIGLFIASKKVNEFTFEYTDCHKATSTFAPVPNNENIKWKYDKAQETCTVQFEIKETFKKPVFFYYRLTSFFQNHRSYVKSYDSEQLLKGKKTDDLKSDCDPFKIKDDKQYFPCGLIANSMFTDVFDNKLVKVTSGNNNETSTESTETYPFTEKGIAWPSDADKYGTRNDFLKFYGNDLSKIMPPPNWSISFPEYKNGYNATNFPDLKNWEHFQVWMRTAGLPNFRKLYSKNTETDLKPGIYNIDIINKYDVNRYGGTKSFVITTTSIIGGRNPFLGVAYIFVGTISLIFGIIFLIRHIYKPRKLGDHRYLSWNKAAAFNRDMDDNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.86
4 0.84
5 0.82
6 0.79
7 0.78
8 0.72
9 0.66
10 0.63
11 0.65
12 0.61
13 0.55
14 0.48
15 0.4
16 0.41
17 0.38
18 0.33
19 0.25
20 0.25
21 0.25
22 0.24
23 0.23
24 0.17
25 0.17
26 0.17
27 0.16
28 0.12
29 0.09
30 0.08
31 0.08
32 0.08
33 0.06
34 0.06
35 0.04
36 0.05
37 0.05
38 0.08
39 0.09
40 0.09
41 0.11
42 0.15
43 0.15
44 0.18
45 0.21
46 0.24
47 0.29
48 0.29
49 0.3
50 0.3
51 0.34
52 0.3
53 0.28
54 0.24
55 0.19
56 0.22
57 0.24
58 0.27
59 0.27
60 0.3
61 0.33
62 0.34
63 0.38
64 0.4
65 0.39
66 0.34
67 0.38
68 0.37
69 0.38
70 0.4
71 0.38
72 0.4
73 0.44
74 0.51
75 0.47
76 0.53
77 0.52
78 0.53
79 0.53
80 0.48
81 0.41
82 0.33
83 0.29
84 0.24
85 0.24
86 0.23
87 0.25
88 0.24
89 0.29
90 0.32
91 0.34
92 0.34
93 0.38
94 0.41
95 0.39
96 0.42
97 0.42
98 0.42
99 0.43
100 0.44
101 0.37
102 0.35
103 0.38
104 0.42
105 0.38
106 0.36
107 0.36
108 0.36
109 0.35
110 0.35
111 0.35
112 0.28
113 0.28
114 0.32
115 0.32
116 0.3
117 0.29
118 0.33
119 0.31
120 0.31
121 0.29
122 0.25
123 0.27
124 0.31
125 0.33
126 0.33
127 0.35
128 0.38
129 0.4
130 0.45
131 0.42
132 0.38
133 0.37
134 0.31
135 0.33
136 0.36
137 0.33
138 0.37
139 0.41
140 0.44
141 0.46
142 0.5
143 0.43
144 0.36
145 0.37
146 0.28
147 0.23
148 0.2
149 0.17
150 0.12
151 0.11
152 0.11
153 0.09
154 0.08
155 0.1
156 0.08
157 0.09
158 0.09
159 0.1
160 0.09
161 0.12
162 0.12
163 0.1
164 0.12
165 0.15
166 0.21
167 0.26
168 0.27
169 0.26
170 0.27
171 0.27
172 0.26
173 0.24
174 0.18
175 0.15
176 0.14
177 0.13
178 0.13
179 0.13
180 0.13
181 0.14
182 0.12
183 0.11
184 0.12
185 0.11
186 0.14
187 0.18
188 0.17
189 0.15
190 0.16
191 0.16
192 0.17
193 0.17
194 0.16
195 0.12
196 0.14
197 0.19
198 0.19
199 0.19
200 0.19
201 0.2
202 0.2
203 0.19
204 0.22
205 0.18
206 0.19
207 0.24
208 0.23
209 0.23
210 0.22
211 0.23
212 0.19
213 0.21
214 0.2
215 0.15
216 0.17
217 0.2
218 0.24
219 0.24
220 0.23
221 0.25
222 0.28
223 0.31
224 0.29
225 0.3
226 0.28
227 0.27
228 0.28
229 0.26
230 0.24
231 0.2
232 0.21
233 0.21
234 0.26
235 0.26
236 0.25
237 0.27
238 0.28
239 0.3
240 0.33
241 0.3
242 0.25
243 0.25
244 0.26
245 0.27
246 0.29
247 0.27
248 0.24
249 0.23
250 0.22
251 0.24
252 0.26
253 0.3
254 0.27
255 0.29
256 0.3
257 0.29
258 0.31
259 0.31
260 0.37
261 0.36
262 0.39
263 0.38
264 0.39
265 0.46
266 0.43
267 0.47
268 0.41
269 0.34
270 0.29
271 0.27
272 0.25
273 0.18
274 0.19
275 0.15
276 0.19
277 0.18
278 0.19
279 0.22
280 0.21
281 0.22
282 0.25
283 0.27
284 0.23
285 0.24
286 0.25
287 0.26
288 0.28
289 0.3
290 0.26
291 0.24
292 0.22
293 0.21
294 0.21
295 0.18
296 0.17
297 0.15
298 0.16
299 0.16
300 0.14
301 0.16
302 0.16
303 0.16
304 0.16
305 0.14
306 0.13
307 0.12
308 0.13
309 0.11
310 0.1
311 0.1
312 0.09
313 0.08
314 0.08
315 0.08
316 0.06
317 0.06
318 0.05
319 0.04
320 0.04
321 0.04
322 0.04
323 0.04
324 0.05
325 0.05
326 0.05
327 0.1
328 0.11
329 0.14
330 0.23
331 0.31
332 0.37
333 0.44
334 0.5
335 0.56
336 0.63
337 0.71
338 0.72
339 0.74
340 0.72
341 0.75
342 0.74
343 0.67
344 0.65
345 0.59
346 0.49
347 0.48
348 0.48
349 0.44
350 0.42
351 0.41
352 0.37