Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1X365

Protein Details
Accession A0A1Y1X365    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-38SCSISQKNTVRQLRNRISKQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12plas 12, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003784  BioY  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0015225  F:biotin transmembrane transporter activity  
Pfam View protein in Pfam  
PF02632  BioY  
Amino Acid Sequences MSEVQTVYISPSYFNTVLSCSISQKNTVRQLRNRISKQYIGIVDNSDNIIFEDDEKKCLLEDDTILKDNQKINLSLHNYPTYTSALTKNISNYFDSRNKDKYDTEQKKGKFSTSFIINLIFIIIGIIFISIFSQISFYLSFNKQIPYTFQTFAVLLNGAVQSPLNSCLSCIFYLILGCIGLPIFAEFSHGISAVTSYSGGFLFGFIFSSPVIGFLSKKGWDKQYRKIWLSMIIGNIIIYIFGFGWYVYKTKEFWGAFPKVVLPFIPGDLFKIFLASLFVPLGWKIFYFRNKKLDLDIESHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.18
4 0.2
5 0.23
6 0.23
7 0.21
8 0.26
9 0.27
10 0.33
11 0.36
12 0.42
13 0.49
14 0.56
15 0.61
16 0.64
17 0.73
18 0.76
19 0.81
20 0.79
21 0.77
22 0.74
23 0.7
24 0.64
25 0.61
26 0.54
27 0.46
28 0.42
29 0.36
30 0.31
31 0.27
32 0.25
33 0.18
34 0.14
35 0.13
36 0.13
37 0.1
38 0.11
39 0.17
40 0.17
41 0.19
42 0.19
43 0.19
44 0.17
45 0.18
46 0.17
47 0.12
48 0.14
49 0.18
50 0.21
51 0.22
52 0.23
53 0.22
54 0.25
55 0.26
56 0.28
57 0.25
58 0.24
59 0.24
60 0.31
61 0.35
62 0.34
63 0.35
64 0.34
65 0.31
66 0.3
67 0.31
68 0.25
69 0.2
70 0.19
71 0.18
72 0.18
73 0.19
74 0.2
75 0.22
76 0.24
77 0.24
78 0.24
79 0.24
80 0.27
81 0.32
82 0.35
83 0.36
84 0.38
85 0.39
86 0.4
87 0.4
88 0.42
89 0.47
90 0.5
91 0.52
92 0.54
93 0.53
94 0.57
95 0.56
96 0.52
97 0.42
98 0.37
99 0.35
100 0.32
101 0.31
102 0.24
103 0.24
104 0.2
105 0.17
106 0.16
107 0.1
108 0.06
109 0.05
110 0.04
111 0.03
112 0.03
113 0.03
114 0.02
115 0.02
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.05
123 0.06
124 0.06
125 0.11
126 0.12
127 0.14
128 0.15
129 0.16
130 0.15
131 0.15
132 0.18
133 0.17
134 0.2
135 0.19
136 0.18
137 0.17
138 0.17
139 0.16
140 0.14
141 0.1
142 0.06
143 0.06
144 0.06
145 0.05
146 0.05
147 0.05
148 0.04
149 0.05
150 0.07
151 0.07
152 0.07
153 0.07
154 0.08
155 0.11
156 0.1
157 0.1
158 0.08
159 0.08
160 0.08
161 0.08
162 0.07
163 0.05
164 0.04
165 0.04
166 0.04
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.06
173 0.06
174 0.07
175 0.07
176 0.08
177 0.07
178 0.07
179 0.07
180 0.05
181 0.05
182 0.05
183 0.04
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.06
192 0.05
193 0.06
194 0.05
195 0.06
196 0.06
197 0.06
198 0.07
199 0.07
200 0.07
201 0.08
202 0.12
203 0.15
204 0.19
205 0.22
206 0.3
207 0.4
208 0.45
209 0.54
210 0.6
211 0.66
212 0.64
213 0.63
214 0.56
215 0.52
216 0.5
217 0.43
218 0.34
219 0.26
220 0.23
221 0.19
222 0.18
223 0.11
224 0.08
225 0.05
226 0.05
227 0.04
228 0.04
229 0.05
230 0.04
231 0.06
232 0.07
233 0.09
234 0.1
235 0.12
236 0.13
237 0.15
238 0.24
239 0.23
240 0.25
241 0.32
242 0.34
243 0.33
244 0.33
245 0.34
246 0.27
247 0.27
248 0.24
249 0.18
250 0.15
251 0.16
252 0.17
253 0.14
254 0.16
255 0.15
256 0.17
257 0.14
258 0.14
259 0.12
260 0.1
261 0.14
262 0.11
263 0.12
264 0.11
265 0.11
266 0.11
267 0.12
268 0.13
269 0.1
270 0.1
271 0.12
272 0.19
273 0.28
274 0.35
275 0.43
276 0.5
277 0.53
278 0.54
279 0.58
280 0.58
281 0.53