Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1VQ29

Protein Details
Accession A0A1Y1VQ29    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
188-216EKWLGEWKSKQKERVRRENDREEKKIRKIBasic
NLS Segment(s)
PositionSequence
195-215KSKQKERVRRENDREEKKIRK
Subcellular Location(s) nucl 13, cyto_nucl 10.833, cyto 6.5, cyto_mito 5.666, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040177  SLC30A9  
Gene Ontology GO:0016020  C:membrane  
GO:0008324  F:monoatomic cation transmembrane transporter activity  
GO:0006829  P:zinc ion transport  
Amino Acid Sequences MHTLNGNIVNIYKSQCKTKISTNSNLIPTLINLNSFYNKNQKVNISLSSQRNNNKISFNNLLKSNTLEIQISPKFKFPIGTIKKYYYFTLTNNTIEEKEEDIAKDDKTYNSIKNNIKFMGIKQSFKNKYHTLTHLKQCQPHKKYQNNINKILKASFSESKKTLKTAEKDKEKEQLKEKSVTKPIDSYEKWLGEWKSKQKERVRRENDREEKKIRKIALEGSFKVVAFAMINSTLMFIAKLYGAIFSHSASMFSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.39
4 0.42
5 0.49
6 0.57
7 0.56
8 0.63
9 0.62
10 0.64
11 0.62
12 0.59
13 0.5
14 0.4
15 0.34
16 0.3
17 0.23
18 0.18
19 0.17
20 0.18
21 0.21
22 0.22
23 0.25
24 0.29
25 0.34
26 0.36
27 0.39
28 0.39
29 0.4
30 0.43
31 0.42
32 0.38
33 0.41
34 0.44
35 0.46
36 0.49
37 0.5
38 0.51
39 0.51
40 0.48
41 0.46
42 0.42
43 0.43
44 0.44
45 0.42
46 0.41
47 0.41
48 0.4
49 0.35
50 0.35
51 0.31
52 0.24
53 0.22
54 0.18
55 0.15
56 0.2
57 0.23
58 0.25
59 0.23
60 0.25
61 0.25
62 0.25
63 0.26
64 0.21
65 0.28
66 0.32
67 0.37
68 0.38
69 0.41
70 0.43
71 0.44
72 0.43
73 0.36
74 0.31
75 0.26
76 0.29
77 0.28
78 0.26
79 0.25
80 0.25
81 0.22
82 0.2
83 0.2
84 0.15
85 0.12
86 0.12
87 0.12
88 0.13
89 0.14
90 0.13
91 0.14
92 0.14
93 0.13
94 0.16
95 0.19
96 0.19
97 0.22
98 0.3
99 0.33
100 0.35
101 0.38
102 0.35
103 0.34
104 0.31
105 0.27
106 0.31
107 0.27
108 0.26
109 0.26
110 0.36
111 0.39
112 0.4
113 0.45
114 0.37
115 0.38
116 0.4
117 0.44
118 0.42
119 0.43
120 0.48
121 0.51
122 0.51
123 0.53
124 0.58
125 0.62
126 0.58
127 0.61
128 0.64
129 0.62
130 0.68
131 0.72
132 0.74
133 0.7
134 0.74
135 0.7
136 0.63
137 0.57
138 0.5
139 0.41
140 0.32
141 0.3
142 0.28
143 0.25
144 0.27
145 0.28
146 0.31
147 0.31
148 0.31
149 0.32
150 0.33
151 0.36
152 0.42
153 0.49
154 0.55
155 0.58
156 0.59
157 0.61
158 0.59
159 0.59
160 0.58
161 0.57
162 0.51
163 0.55
164 0.55
165 0.55
166 0.58
167 0.55
168 0.49
169 0.43
170 0.41
171 0.42
172 0.39
173 0.37
174 0.36
175 0.34
176 0.33
177 0.36
178 0.36
179 0.35
180 0.42
181 0.45
182 0.5
183 0.54
184 0.63
185 0.66
186 0.75
187 0.77
188 0.8
189 0.8
190 0.81
191 0.85
192 0.87
193 0.88
194 0.86
195 0.84
196 0.82
197 0.81
198 0.78
199 0.76
200 0.67
201 0.6
202 0.54
203 0.55
204 0.56
205 0.54
206 0.48
207 0.46
208 0.45
209 0.41
210 0.38
211 0.3
212 0.21
213 0.14
214 0.13
215 0.1
216 0.09
217 0.1
218 0.09
219 0.1
220 0.09
221 0.09
222 0.08
223 0.06
224 0.07
225 0.07
226 0.07
227 0.07
228 0.09
229 0.09
230 0.11
231 0.12
232 0.11
233 0.14
234 0.14