Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XH93

Protein Details
Accession A0A1Y1XH93    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-110VGSTFCKKKEKTKRKSINNNFKSLHydrophilic
NLS Segment(s)
PositionSequence
97-99KTK
Subcellular Location(s) nucl 19, cyto 7
Family & Domain DBs
Amino Acid Sequences MSVEEIKKEVNTDNLNDYLKEIKTMLIKKAIETNIYALCNIVKEENIEFEKSSLKEFNELIKNVYEDVSEKMNIDLKYKPFTSASYVGSTFCKKKEKTKRKSINNNFKSLNEMNMPIPNARICSDSIVELYNITREEDYDIYMADIPIEYRKKILNITIFYGEKDSFSTRKLYTVIGNTSRGSVELIVDNIPDKVLNMYNLVVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.31
4 0.31
5 0.29
6 0.25
7 0.24
8 0.2
9 0.19
10 0.25
11 0.29
12 0.3
13 0.33
14 0.33
15 0.33
16 0.41
17 0.39
18 0.33
19 0.31
20 0.3
21 0.26
22 0.27
23 0.25
24 0.18
25 0.16
26 0.15
27 0.15
28 0.12
29 0.09
30 0.1
31 0.11
32 0.15
33 0.17
34 0.18
35 0.17
36 0.17
37 0.21
38 0.2
39 0.22
40 0.2
41 0.19
42 0.2
43 0.21
44 0.27
45 0.29
46 0.29
47 0.27
48 0.26
49 0.25
50 0.23
51 0.22
52 0.16
53 0.11
54 0.12
55 0.12
56 0.11
57 0.11
58 0.12
59 0.17
60 0.17
61 0.18
62 0.2
63 0.2
64 0.23
65 0.23
66 0.24
67 0.2
68 0.2
69 0.23
70 0.23
71 0.22
72 0.21
73 0.21
74 0.2
75 0.21
76 0.23
77 0.2
78 0.2
79 0.26
80 0.25
81 0.35
82 0.46
83 0.55
84 0.61
85 0.71
86 0.77
87 0.8
88 0.9
89 0.91
90 0.91
91 0.84
92 0.8
93 0.7
94 0.6
95 0.55
96 0.44
97 0.36
98 0.26
99 0.23
100 0.18
101 0.19
102 0.19
103 0.13
104 0.14
105 0.12
106 0.12
107 0.11
108 0.12
109 0.1
110 0.12
111 0.12
112 0.12
113 0.12
114 0.11
115 0.1
116 0.09
117 0.09
118 0.09
119 0.08
120 0.09
121 0.08
122 0.08
123 0.11
124 0.11
125 0.11
126 0.1
127 0.1
128 0.1
129 0.1
130 0.09
131 0.07
132 0.06
133 0.06
134 0.12
135 0.14
136 0.13
137 0.14
138 0.16
139 0.18
140 0.2
141 0.26
142 0.26
143 0.27
144 0.3
145 0.34
146 0.33
147 0.31
148 0.32
149 0.27
150 0.2
151 0.21
152 0.21
153 0.17
154 0.18
155 0.23
156 0.2
157 0.23
158 0.24
159 0.24
160 0.24
161 0.29
162 0.34
163 0.33
164 0.35
165 0.32
166 0.32
167 0.3
168 0.26
169 0.22
170 0.15
171 0.13
172 0.12
173 0.13
174 0.12
175 0.13
176 0.13
177 0.12
178 0.11
179 0.1
180 0.08
181 0.11
182 0.13
183 0.14
184 0.15