Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X3M1

Protein Details
Accession A0A1Y1X3M1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
79-104NNNNNNNKKEKNKKEKDKNNNNNFWGHydrophilic
NLS Segment(s)
PositionSequence
91-91K
Subcellular Location(s) extr 13, mito 8, cyto 3, vacu 3
Family & Domain DBs
Amino Acid Sequences MNFYHLLLIFALNFLYVVKTMPVPFSGFKFPAMLSTFTNPFYEKKKDVKYVNFFDNFFTNGGWGGNNNNGWGNFGGWGNNNNNNNKKEKNKKEKDKNNNNNFWGGDIWGLGNNNGGNGGNNGGNGGGKGHGATSSTYEFDTSNITVELYDEDADVEVVNPIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.07
6 0.1
7 0.11
8 0.12
9 0.13
10 0.15
11 0.16
12 0.19
13 0.24
14 0.23
15 0.23
16 0.23
17 0.21
18 0.23
19 0.24
20 0.23
21 0.2
22 0.23
23 0.23
24 0.23
25 0.25
26 0.21
27 0.21
28 0.25
29 0.29
30 0.3
31 0.36
32 0.42
33 0.48
34 0.54
35 0.6
36 0.62
37 0.61
38 0.63
39 0.57
40 0.51
41 0.44
42 0.39
43 0.31
44 0.24
45 0.18
46 0.12
47 0.1
48 0.09
49 0.08
50 0.07
51 0.07
52 0.09
53 0.09
54 0.1
55 0.1
56 0.1
57 0.11
58 0.11
59 0.1
60 0.08
61 0.08
62 0.09
63 0.08
64 0.11
65 0.12
66 0.17
67 0.2
68 0.24
69 0.3
70 0.31
71 0.35
72 0.37
73 0.44
74 0.49
75 0.56
76 0.63
77 0.68
78 0.77
79 0.83
80 0.89
81 0.91
82 0.92
83 0.92
84 0.91
85 0.88
86 0.78
87 0.7
88 0.6
89 0.5
90 0.38
91 0.28
92 0.18
93 0.11
94 0.1
95 0.08
96 0.08
97 0.07
98 0.08
99 0.07
100 0.07
101 0.08
102 0.07
103 0.07
104 0.07
105 0.09
106 0.07
107 0.07
108 0.08
109 0.07
110 0.07
111 0.07
112 0.07
113 0.06
114 0.05
115 0.06
116 0.06
117 0.06
118 0.07
119 0.08
120 0.11
121 0.12
122 0.13
123 0.13
124 0.14
125 0.14
126 0.13
127 0.16
128 0.13
129 0.13
130 0.12
131 0.12
132 0.11
133 0.12
134 0.12
135 0.1
136 0.1
137 0.08
138 0.09
139 0.09
140 0.09
141 0.08
142 0.07