Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1DX84

Protein Details
Accession A0A0D1DX84   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
120-141SALLRSQRGRKQPPARRVRGTGHydrophilic
NLS Segment(s)
PositionSequence
124-144RSQRGRKQPPARRVRGTGARK
Subcellular Location(s) mito 15, nucl 7, cyto_nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR002672  Ribosomal_L28e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG uma:UMAG_11561  -  
Pfam View protein in Pfam  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MASQDLQWLLVRNNSSFIVKQKGIGRIFSREPRNLVQLHSYKYSGLVNAKAVGIEAAKSGKGVVITTKNAKQSSSAIKKTVNVATLKKGGGRRTAGAVSNVVAKKGYRADLTRAAVIRASALLRSQRGRKQPPARRVRGTGARKVVKVEEPVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.27
5 0.3
6 0.28
7 0.32
8 0.35
9 0.42
10 0.41
11 0.44
12 0.42
13 0.4
14 0.46
15 0.49
16 0.5
17 0.45
18 0.48
19 0.45
20 0.47
21 0.43
22 0.38
23 0.39
24 0.37
25 0.37
26 0.35
27 0.32
28 0.27
29 0.28
30 0.27
31 0.21
32 0.19
33 0.17
34 0.15
35 0.16
36 0.16
37 0.14
38 0.13
39 0.1
40 0.08
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.09
51 0.11
52 0.14
53 0.18
54 0.21
55 0.24
56 0.24
57 0.24
58 0.23
59 0.23
60 0.31
61 0.34
62 0.33
63 0.31
64 0.32
65 0.33
66 0.35
67 0.33
68 0.26
69 0.21
70 0.21
71 0.22
72 0.24
73 0.23
74 0.23
75 0.25
76 0.24
77 0.26
78 0.27
79 0.25
80 0.25
81 0.27
82 0.25
83 0.22
84 0.2
85 0.16
86 0.2
87 0.19
88 0.16
89 0.15
90 0.14
91 0.15
92 0.18
93 0.2
94 0.16
95 0.19
96 0.23
97 0.3
98 0.32
99 0.33
100 0.31
101 0.29
102 0.26
103 0.23
104 0.19
105 0.13
106 0.12
107 0.08
108 0.11
109 0.14
110 0.17
111 0.22
112 0.29
113 0.35
114 0.45
115 0.52
116 0.6
117 0.67
118 0.73
119 0.79
120 0.83
121 0.84
122 0.81
123 0.78
124 0.77
125 0.76
126 0.74
127 0.72
128 0.71
129 0.69
130 0.63
131 0.62
132 0.57
133 0.52