Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WUA0

Protein Details
Accession A0A1Y1WUA0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
108-129MGPINDKKDNRKLKNLNTKFNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 10, cyto_nucl 7.333, mito_nucl 7.333, cyto_pero 5.833
Family & Domain DBs
Amino Acid Sequences MEVSFGAGSRPGAGLRTRGISCNHRDIQKAFPHELGDDKILPVLKYHCWRDKRAYSEARGIRRRYRNVRANLNVPAVNTTAAEQWYPLRNSLHTYMVLHSCVGHIMEMGPINDKKDNRKLKNLNTKFNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.22
4 0.22
5 0.24
6 0.29
7 0.33
8 0.37
9 0.43
10 0.46
11 0.44
12 0.46
13 0.46
14 0.49
15 0.49
16 0.48
17 0.41
18 0.38
19 0.36
20 0.33
21 0.33
22 0.27
23 0.22
24 0.17
25 0.15
26 0.15
27 0.15
28 0.15
29 0.14
30 0.14
31 0.16
32 0.22
33 0.28
34 0.34
35 0.37
36 0.41
37 0.48
38 0.52
39 0.53
40 0.55
41 0.54
42 0.5
43 0.54
44 0.55
45 0.55
46 0.55
47 0.53
48 0.53
49 0.55
50 0.6
51 0.59
52 0.64
53 0.64
54 0.64
55 0.69
56 0.64
57 0.6
58 0.55
59 0.5
60 0.41
61 0.32
62 0.27
63 0.19
64 0.16
65 0.13
66 0.1
67 0.09
68 0.09
69 0.09
70 0.08
71 0.1
72 0.15
73 0.15
74 0.17
75 0.17
76 0.17
77 0.22
78 0.24
79 0.24
80 0.2
81 0.2
82 0.21
83 0.21
84 0.21
85 0.17
86 0.15
87 0.12
88 0.12
89 0.11
90 0.08
91 0.06
92 0.06
93 0.08
94 0.1
95 0.1
96 0.14
97 0.15
98 0.18
99 0.23
100 0.26
101 0.32
102 0.41
103 0.51
104 0.53
105 0.63
106 0.69
107 0.75
108 0.84
109 0.84