Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X899

Protein Details
Accession A0A1Y1X899   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
30-49KNTLAERKQRQENKLKNKSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR044611  E3A/B/C-like  
IPR000048  IQ_motif_EF-hand-BS  
Gene Ontology GO:0061630  F:ubiquitin protein ligase activity  
GO:0000209  P:protein polyubiquitination  
PROSITE View protein in PROSITE  
PS50096  IQ  
Amino Acid Sequences MYGFEFGAHKTRKINLGGITNQQDKKMLLKNTLAERKQRQENKLKNKSATKIQAFWRGRKEFEELKRNLMKEWKKECKEIINNPEDCEIENVISIFRKFLIFYKSRNSRVQDLIFMCKTLLTKKDDSVEIILLPLSDDDYIKDSINQLRMFIPYCIKGIPGLER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.37
3 0.41
4 0.42
5 0.46
6 0.48
7 0.49
8 0.48
9 0.43
10 0.41
11 0.35
12 0.37
13 0.38
14 0.35
15 0.32
16 0.34
17 0.39
18 0.46
19 0.55
20 0.51
21 0.52
22 0.56
23 0.59
24 0.65
25 0.67
26 0.66
27 0.68
28 0.75
29 0.78
30 0.81
31 0.79
32 0.76
33 0.75
34 0.71
35 0.69
36 0.68
37 0.61
38 0.56
39 0.54
40 0.58
41 0.55
42 0.56
43 0.56
44 0.49
45 0.47
46 0.44
47 0.44
48 0.42
49 0.46
50 0.5
51 0.42
52 0.47
53 0.5
54 0.48
55 0.44
56 0.45
57 0.42
58 0.42
59 0.5
60 0.53
61 0.51
62 0.53
63 0.54
64 0.54
65 0.56
66 0.54
67 0.52
68 0.49
69 0.47
70 0.45
71 0.45
72 0.36
73 0.29
74 0.23
75 0.16
76 0.09
77 0.09
78 0.08
79 0.07
80 0.08
81 0.07
82 0.06
83 0.06
84 0.06
85 0.07
86 0.1
87 0.16
88 0.18
89 0.2
90 0.29
91 0.36
92 0.41
93 0.46
94 0.48
95 0.46
96 0.49
97 0.48
98 0.44
99 0.39
100 0.4
101 0.35
102 0.31
103 0.26
104 0.21
105 0.21
106 0.19
107 0.22
108 0.21
109 0.23
110 0.26
111 0.3
112 0.29
113 0.31
114 0.29
115 0.25
116 0.19
117 0.17
118 0.15
119 0.11
120 0.1
121 0.08
122 0.06
123 0.06
124 0.06
125 0.07
126 0.1
127 0.11
128 0.12
129 0.13
130 0.15
131 0.2
132 0.26
133 0.25
134 0.24
135 0.24
136 0.26
137 0.28
138 0.27
139 0.26
140 0.22
141 0.23
142 0.22
143 0.21
144 0.2