Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X466

Protein Details
Accession A0A1Y1X466    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-57KNDAPTSPTKKSRKREHEEIDSEHydrophilic
83-119KPNFNKYKKRGSKKVGGKKISKKYNEQKRKNILKNVDHydrophilic
NLS Segment(s)
PositionSequence
29-49KKAKLSKNDAPTSPTKKSRKR
86-112FNKYKKRGSKKVGGKKISKKYNEQKRK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPYNTRLRGKNPYNAGEVDKKDALASPTKKAKLSKNDAPTSPTKKSRKREHEEIDSELKNMKKKLNSQINELNGTKPSEITPKPNFNKYKKRGSKKVGGKKISKKYNEQKRKNILKNVDASNLKHVRCVVNSEILSKGLCNTINSLGPEKIMDVLKNGKSEETQKTETEKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.51
4 0.47
5 0.44
6 0.37
7 0.33
8 0.3
9 0.3
10 0.27
11 0.29
12 0.29
13 0.31
14 0.39
15 0.42
16 0.46
17 0.49
18 0.55
19 0.56
20 0.62
21 0.62
22 0.64
23 0.66
24 0.63
25 0.63
26 0.62
27 0.59
28 0.57
29 0.58
30 0.58
31 0.62
32 0.7
33 0.77
34 0.79
35 0.81
36 0.84
37 0.83
38 0.83
39 0.78
40 0.72
41 0.68
42 0.57
43 0.49
44 0.42
45 0.36
46 0.3
47 0.29
48 0.29
49 0.28
50 0.34
51 0.43
52 0.5
53 0.49
54 0.51
55 0.55
56 0.53
57 0.52
58 0.47
59 0.38
60 0.29
61 0.28
62 0.22
63 0.16
64 0.14
65 0.16
66 0.17
67 0.22
68 0.26
69 0.34
70 0.37
71 0.45
72 0.51
73 0.53
74 0.63
75 0.61
76 0.67
77 0.67
78 0.74
79 0.75
80 0.74
81 0.76
82 0.76
83 0.8
84 0.78
85 0.76
86 0.75
87 0.76
88 0.79
89 0.77
90 0.71
91 0.7
92 0.71
93 0.76
94 0.78
95 0.77
96 0.77
97 0.8
98 0.86
99 0.84
100 0.82
101 0.76
102 0.71
103 0.69
104 0.62
105 0.58
106 0.5
107 0.44
108 0.45
109 0.45
110 0.39
111 0.35
112 0.34
113 0.3
114 0.28
115 0.32
116 0.25
117 0.27
118 0.28
119 0.28
120 0.27
121 0.25
122 0.24
123 0.19
124 0.17
125 0.13
126 0.14
127 0.13
128 0.15
129 0.17
130 0.21
131 0.23
132 0.25
133 0.22
134 0.22
135 0.21
136 0.19
137 0.19
138 0.18
139 0.16
140 0.17
141 0.24
142 0.26
143 0.29
144 0.29
145 0.27
146 0.28
147 0.34
148 0.39
149 0.39
150 0.39
151 0.4