Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WWQ3

Protein Details
Accession A0A1Y1WWQ3   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
295-318LILLCRKKDTINNKKDKKQYLVLDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 7, nucl 4, E.R. 4, mito 3, pero 3, golg 3, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001611  Leu-rich_rpt  
IPR003591  Leu-rich_rpt_typical-subtyp  
IPR032675  LRR_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13855  LRR_8  
Amino Acid Sequences MKMKNIKYSSKKWLNLLITSACIIGNNILKVKADDCKYIENAINFFGNDIKAKYDKDKPSDCCKFEGVICKVINNENHVVEINFNEYRTFDGKESEAIKELSNLEHLETLTLRSFLFDGRFPVGFGKLKSLKTLNLIHNTFMTPIPDELGELVNLNKLDLSYNYLRGSVPSSLGNLKKLKILNLKHNRLKGVLPYEFRNMTNLEQLLLDHNISLSGYVPLIDKLGICSYSATNLCNLKEAKCKDADYDCSKEDIKKTDELNGNPDPIKNSYLTMKPKPTHKIITGILIILIITILILLCRKKDTINNKKDKKQYLVLDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.59
3 0.56
4 0.47
5 0.39
6 0.35
7 0.31
8 0.21
9 0.17
10 0.15
11 0.14
12 0.16
13 0.17
14 0.18
15 0.19
16 0.2
17 0.21
18 0.23
19 0.26
20 0.25
21 0.27
22 0.28
23 0.33
24 0.34
25 0.36
26 0.38
27 0.33
28 0.31
29 0.28
30 0.27
31 0.21
32 0.2
33 0.18
34 0.15
35 0.15
36 0.14
37 0.16
38 0.18
39 0.21
40 0.26
41 0.34
42 0.4
43 0.46
44 0.53
45 0.55
46 0.63
47 0.7
48 0.66
49 0.6
50 0.54
51 0.49
52 0.44
53 0.48
54 0.4
55 0.38
56 0.36
57 0.34
58 0.33
59 0.36
60 0.35
61 0.3
62 0.3
63 0.23
64 0.23
65 0.23
66 0.21
67 0.18
68 0.16
69 0.16
70 0.13
71 0.13
72 0.13
73 0.12
74 0.15
75 0.17
76 0.18
77 0.14
78 0.16
79 0.16
80 0.2
81 0.22
82 0.2
83 0.2
84 0.18
85 0.18
86 0.18
87 0.18
88 0.14
89 0.14
90 0.13
91 0.12
92 0.12
93 0.12
94 0.11
95 0.1
96 0.11
97 0.1
98 0.1
99 0.09
100 0.08
101 0.09
102 0.09
103 0.1
104 0.1
105 0.11
106 0.13
107 0.13
108 0.13
109 0.14
110 0.16
111 0.16
112 0.16
113 0.21
114 0.23
115 0.24
116 0.26
117 0.26
118 0.25
119 0.27
120 0.33
121 0.31
122 0.34
123 0.34
124 0.31
125 0.31
126 0.3
127 0.26
128 0.2
129 0.16
130 0.09
131 0.09
132 0.09
133 0.08
134 0.07
135 0.07
136 0.07
137 0.06
138 0.05
139 0.06
140 0.07
141 0.06
142 0.06
143 0.06
144 0.05
145 0.06
146 0.06
147 0.11
148 0.1
149 0.13
150 0.13
151 0.14
152 0.14
153 0.14
154 0.16
155 0.11
156 0.11
157 0.09
158 0.11
159 0.14
160 0.15
161 0.19
162 0.19
163 0.19
164 0.22
165 0.22
166 0.26
167 0.3
168 0.33
169 0.39
170 0.48
171 0.56
172 0.57
173 0.59
174 0.55
175 0.48
176 0.46
177 0.4
178 0.36
179 0.32
180 0.29
181 0.29
182 0.31
183 0.31
184 0.3
185 0.27
186 0.22
187 0.19
188 0.21
189 0.18
190 0.15
191 0.13
192 0.13
193 0.14
194 0.13
195 0.12
196 0.08
197 0.08
198 0.07
199 0.07
200 0.07
201 0.05
202 0.05
203 0.05
204 0.05
205 0.06
206 0.06
207 0.07
208 0.07
209 0.06
210 0.07
211 0.09
212 0.09
213 0.09
214 0.1
215 0.1
216 0.14
217 0.15
218 0.13
219 0.16
220 0.19
221 0.19
222 0.23
223 0.24
224 0.23
225 0.31
226 0.33
227 0.33
228 0.34
229 0.34
230 0.34
231 0.38
232 0.42
233 0.39
234 0.42
235 0.38
236 0.38
237 0.38
238 0.38
239 0.37
240 0.35
241 0.33
242 0.33
243 0.33
244 0.39
245 0.44
246 0.42
247 0.44
248 0.4
249 0.41
250 0.36
251 0.36
252 0.31
253 0.27
254 0.27
255 0.22
256 0.21
257 0.23
258 0.29
259 0.36
260 0.4
261 0.47
262 0.49
263 0.56
264 0.61
265 0.63
266 0.62
267 0.58
268 0.58
269 0.51
270 0.52
271 0.45
272 0.38
273 0.31
274 0.24
275 0.2
276 0.13
277 0.11
278 0.04
279 0.03
280 0.03
281 0.03
282 0.03
283 0.07
284 0.08
285 0.1
286 0.13
287 0.15
288 0.19
289 0.28
290 0.39
291 0.47
292 0.57
293 0.67
294 0.74
295 0.82
296 0.87
297 0.86
298 0.83
299 0.81