Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1X5Z0

Protein Details
Accession A0A1Y1X5Z0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
82-103LVYLKFKPRCKSIKKYLKVKNKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 11, cyto 10, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRNEECLSNVCNKGGICEEAISARVGEYQYGYLYGEKCSSDNECFDGKCVLGTCGNQIRDYINDNIYMIISIVFIIIAVILLVYLKFKPRCKSIKKYLKVKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.18
4 0.17
5 0.17
6 0.14
7 0.16
8 0.13
9 0.1
10 0.09
11 0.1
12 0.09
13 0.09
14 0.09
15 0.09
16 0.08
17 0.09
18 0.1
19 0.1
20 0.1
21 0.11
22 0.11
23 0.11
24 0.11
25 0.13
26 0.15
27 0.14
28 0.15
29 0.16
30 0.17
31 0.16
32 0.17
33 0.16
34 0.12
35 0.11
36 0.11
37 0.09
38 0.09
39 0.09
40 0.12
41 0.16
42 0.17
43 0.16
44 0.16
45 0.16
46 0.16
47 0.19
48 0.18
49 0.14
50 0.14
51 0.14
52 0.13
53 0.12
54 0.11
55 0.08
56 0.05
57 0.04
58 0.04
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.04
71 0.05
72 0.13
73 0.18
74 0.25
75 0.31
76 0.4
77 0.5
78 0.58
79 0.67
80 0.71
81 0.77
82 0.81
83 0.86