Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XFS7

Protein Details
Accession A0A1Y1XFS7   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-23AKNKGNKKDKGNAKGNNKGNEKBasic
NLS Segment(s)
PositionSequence
5-18KGNKKDKGNAKGNN
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, cyto 8, cyto_pero 4.833, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003746  DUF167  
IPR036591  YggU-like_sf  
Pfam View protein in Pfam  
PF02594  DUF167  
Amino Acid Sequences MAKNKGNKKDKGNAKGNNKGNEKESNEIKRGPIQMLKDNTLRIQLQVKPNAQISQVIEYTNDYVGVQLSAPPKDGEANTECVKYMAEALGVKKSEVSLIGGMKSREKVIRVETSDIDGIEKRLKSLVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.81
4 0.8
5 0.75
6 0.68
7 0.63
8 0.62
9 0.56
10 0.53
11 0.53
12 0.51
13 0.49
14 0.48
15 0.46
16 0.43
17 0.41
18 0.38
19 0.34
20 0.31
21 0.35
22 0.37
23 0.39
24 0.35
25 0.34
26 0.32
27 0.31
28 0.28
29 0.22
30 0.23
31 0.24
32 0.29
33 0.33
34 0.34
35 0.32
36 0.34
37 0.33
38 0.29
39 0.26
40 0.21
41 0.18
42 0.17
43 0.15
44 0.14
45 0.13
46 0.14
47 0.11
48 0.1
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.07
55 0.08
56 0.09
57 0.1
58 0.09
59 0.1
60 0.11
61 0.12
62 0.12
63 0.13
64 0.17
65 0.17
66 0.18
67 0.17
68 0.16
69 0.16
70 0.12
71 0.11
72 0.07
73 0.07
74 0.08
75 0.1
76 0.14
77 0.14
78 0.14
79 0.13
80 0.13
81 0.12
82 0.11
83 0.12
84 0.11
85 0.11
86 0.13
87 0.16
88 0.17
89 0.19
90 0.2
91 0.21
92 0.21
93 0.22
94 0.24
95 0.28
96 0.35
97 0.36
98 0.39
99 0.37
100 0.38
101 0.37
102 0.33
103 0.3
104 0.22
105 0.21
106 0.24
107 0.23
108 0.2