Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XFG3

Protein Details
Accession A0A1Y1XFG3   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
157-176ESILKEKPPNRNHYNNNSITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8mito 8cyto 8cyto_nucl 8cyto_mito 8mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR026302  NEDD4_b_p2  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF13671  AAA_33  
Amino Acid Sequences MTDNNNNNNNSNDKIMYILRGLPGSGKSTLAKSIIKENNGKGIILSTDNYFIVNGKDQYDPTKIGEAHQSNQNKCKEKCEQGISPIIIDNTNIKRWEAKPYVEIALEYNYKIEIREPDTPWFKERNAKRLAKKSIHNVTIKKITGMISKWDEDFSIESILKEKPPNRNHYNNNSITNKFNKKKLNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.23
4 0.2
5 0.19
6 0.17
7 0.17
8 0.17
9 0.16
10 0.17
11 0.18
12 0.17
13 0.17
14 0.17
15 0.18
16 0.21
17 0.22
18 0.22
19 0.21
20 0.3
21 0.33
22 0.36
23 0.39
24 0.38
25 0.43
26 0.41
27 0.39
28 0.29
29 0.25
30 0.22
31 0.18
32 0.18
33 0.11
34 0.12
35 0.12
36 0.12
37 0.11
38 0.1
39 0.1
40 0.13
41 0.13
42 0.13
43 0.15
44 0.15
45 0.19
46 0.21
47 0.21
48 0.19
49 0.23
50 0.2
51 0.21
52 0.28
53 0.27
54 0.27
55 0.33
56 0.37
57 0.35
58 0.42
59 0.47
60 0.47
61 0.45
62 0.49
63 0.49
64 0.49
65 0.53
66 0.52
67 0.47
68 0.43
69 0.47
70 0.4
71 0.34
72 0.28
73 0.21
74 0.15
75 0.14
76 0.15
77 0.12
78 0.15
79 0.15
80 0.14
81 0.18
82 0.19
83 0.27
84 0.25
85 0.24
86 0.23
87 0.25
88 0.26
89 0.23
90 0.22
91 0.14
92 0.14
93 0.14
94 0.12
95 0.1
96 0.09
97 0.09
98 0.09
99 0.1
100 0.1
101 0.14
102 0.21
103 0.23
104 0.29
105 0.34
106 0.35
107 0.37
108 0.37
109 0.34
110 0.36
111 0.39
112 0.41
113 0.45
114 0.52
115 0.57
116 0.63
117 0.7
118 0.68
119 0.69
120 0.7
121 0.7
122 0.69
123 0.67
124 0.6
125 0.57
126 0.58
127 0.53
128 0.44
129 0.37
130 0.32
131 0.3
132 0.29
133 0.29
134 0.25
135 0.27
136 0.27
137 0.25
138 0.23
139 0.21
140 0.21
141 0.16
142 0.16
143 0.15
144 0.14
145 0.16
146 0.18
147 0.2
148 0.25
149 0.29
150 0.35
151 0.43
152 0.53
153 0.59
154 0.67
155 0.73
156 0.76
157 0.8
158 0.76
159 0.76
160 0.73
161 0.67
162 0.63
163 0.64
164 0.65
165 0.61
166 0.63