Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XNH1

Protein Details
Accession A0A1Y1XNH1    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-29QARTTQARTQKQKTKTNTNQKTETHydrophilic
37-62NNNNNGRRPNNKKKANRHPVGRKLGSHydrophilic
NLS Segment(s)
PositionSequence
43-59RRPNNKKKANRHPVGRK
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MTRTIQARTTQARTQKQKTKTNTNQKTETNTNTTNSNNNNNGRRPNNKKKANRHPVGRKLGSENPGVNIKNLSPEERRKLMAEAAEKRFNNNNNNNENNNEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.71
3 0.73
4 0.76
5 0.78
6 0.8
7 0.81
8 0.83
9 0.84
10 0.82
11 0.79
12 0.73
13 0.73
14 0.67
15 0.61
16 0.56
17 0.48
18 0.42
19 0.39
20 0.37
21 0.35
22 0.33
23 0.34
24 0.34
25 0.38
26 0.42
27 0.42
28 0.48
29 0.48
30 0.54
31 0.57
32 0.62
33 0.67
34 0.71
35 0.76
36 0.8
37 0.86
38 0.87
39 0.84
40 0.82
41 0.81
42 0.81
43 0.8
44 0.72
45 0.62
46 0.57
47 0.55
48 0.48
49 0.42
50 0.33
51 0.26
52 0.29
53 0.28
54 0.23
55 0.19
56 0.17
57 0.2
58 0.2
59 0.23
60 0.24
61 0.31
62 0.37
63 0.39
64 0.4
65 0.36
66 0.37
67 0.36
68 0.35
69 0.36
70 0.38
71 0.41
72 0.48
73 0.46
74 0.48
75 0.52
76 0.52
77 0.54
78 0.55
79 0.58
80 0.58
81 0.64
82 0.63
83 0.6