Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1X179

Protein Details
Accession A0A1Y1X179    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-33IVPNLKRYNKKDHRTLRHNNNNNNNHNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MNNNIIVPNLKRYNKKDHRTLRHNNNNNNNHNNNNHNNNNHNNNNNHNNNNNNNDNHNNNNLNMQLEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.73
4 0.75
5 0.79
6 0.81
7 0.86
8 0.86
9 0.86
10 0.87
11 0.86
12 0.85
13 0.84
14 0.8
15 0.77
16 0.69
17 0.61
18 0.56
19 0.53
20 0.48
21 0.46
22 0.44
23 0.4
24 0.42
25 0.43
26 0.47
27 0.45
28 0.45
29 0.41
30 0.44
31 0.5
32 0.51
33 0.5
34 0.47
35 0.49
36 0.5
37 0.54
38 0.53
39 0.46
40 0.46
41 0.47
42 0.47
43 0.46
44 0.47
45 0.43
46 0.38
47 0.39
48 0.35