Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8PPJ4

Protein Details
Accession B8PPJ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MLRLKPRLPRLQPPHRHASTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR005720  Dihydroorotate_DH  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016627  F:oxidoreductase activity, acting on the CH-CH group of donors  
KEGG ppl:POSPLDRAFT_102460  -  
Pfam View protein in Pfam  
PF01180  DHO_dh  
Amino Acid Sequences MLRLKPRLPRLQPPHRHASTSSVTPSASSLRTGLYASALLLSTGVFAAYYFDSRAALHRYVVTPVLRHTLDPETAHRLAVRVLASGWAPRDTRPDDEVLRTELWGEELANPVGLAAGFDKHGEAVDGLFDLGFSWVEIGSITPKPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.7
4 0.61
5 0.58
6 0.51
7 0.46
8 0.41
9 0.33
10 0.3
11 0.27
12 0.27
13 0.23
14 0.19
15 0.15
16 0.13
17 0.12
18 0.13
19 0.13
20 0.12
21 0.1
22 0.09
23 0.08
24 0.08
25 0.08
26 0.06
27 0.06
28 0.06
29 0.05
30 0.04
31 0.04
32 0.03
33 0.03
34 0.05
35 0.05
36 0.06
37 0.06
38 0.07
39 0.07
40 0.08
41 0.11
42 0.13
43 0.13
44 0.13
45 0.15
46 0.15
47 0.16
48 0.18
49 0.16
50 0.13
51 0.13
52 0.16
53 0.15
54 0.14
55 0.15
56 0.15
57 0.16
58 0.16
59 0.17
60 0.19
61 0.19
62 0.19
63 0.17
64 0.15
65 0.14
66 0.15
67 0.13
68 0.08
69 0.07
70 0.08
71 0.08
72 0.09
73 0.1
74 0.1
75 0.11
76 0.11
77 0.17
78 0.18
79 0.21
80 0.22
81 0.24
82 0.24
83 0.26
84 0.26
85 0.24
86 0.22
87 0.19
88 0.17
89 0.14
90 0.13
91 0.11
92 0.1
93 0.08
94 0.1
95 0.1
96 0.09
97 0.09
98 0.08
99 0.08
100 0.07
101 0.06
102 0.04
103 0.05
104 0.06
105 0.06
106 0.06
107 0.06
108 0.07
109 0.07
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.06
126 0.1