Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1XGS0

Protein Details
Accession A0A1Y1XGS0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAVKKKDKNQKKSKNKKELKNDMKSELDHydrophilic
NLS Segment(s)
PositionSequence
4-20KKKDKNQKKSKNKKELK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR032777  DUF4515  
Pfam View protein in Pfam  
PF14988  DUF4515  
Amino Acid Sequences MAVKKKDKNQKKSKNKKELKNDMKSELDKIRNPTMEKLYETASKENEQYKIRIENLIRTIDNLQEKCRSQDNDALEVISTLQRETETKDTKIKLLEGQMDNERENSRLEKESIIKDYESQLADIRENLKEKEISLKVIKDEFNVLKDFRRKRRELMQELERKNNDMIEIEKTNKEKIERLEKKFFEEKVRLQKETNKKLAELASKAHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.95
3 0.94
4 0.94
5 0.94
6 0.93
7 0.92
8 0.86
9 0.8
10 0.77
11 0.69
12 0.63
13 0.6
14 0.56
15 0.51
16 0.51
17 0.53
18 0.51
19 0.52
20 0.51
21 0.49
22 0.45
23 0.43
24 0.38
25 0.34
26 0.35
27 0.35
28 0.33
29 0.3
30 0.29
31 0.31
32 0.33
33 0.35
34 0.32
35 0.31
36 0.32
37 0.34
38 0.33
39 0.35
40 0.32
41 0.33
42 0.34
43 0.36
44 0.32
45 0.29
46 0.29
47 0.28
48 0.33
49 0.27
50 0.27
51 0.28
52 0.29
53 0.3
54 0.35
55 0.33
56 0.29
57 0.34
58 0.34
59 0.32
60 0.31
61 0.29
62 0.22
63 0.2
64 0.17
65 0.13
66 0.09
67 0.06
68 0.06
69 0.06
70 0.07
71 0.11
72 0.18
73 0.21
74 0.23
75 0.28
76 0.29
77 0.3
78 0.31
79 0.28
80 0.22
81 0.21
82 0.26
83 0.21
84 0.23
85 0.24
86 0.24
87 0.24
88 0.23
89 0.21
90 0.15
91 0.15
92 0.14
93 0.14
94 0.14
95 0.15
96 0.15
97 0.18
98 0.2
99 0.21
100 0.21
101 0.18
102 0.17
103 0.18
104 0.19
105 0.16
106 0.14
107 0.14
108 0.14
109 0.14
110 0.14
111 0.14
112 0.14
113 0.15
114 0.15
115 0.16
116 0.15
117 0.15
118 0.22
119 0.21
120 0.22
121 0.23
122 0.24
123 0.24
124 0.27
125 0.27
126 0.2
127 0.24
128 0.22
129 0.21
130 0.22
131 0.21
132 0.24
133 0.32
134 0.4
135 0.44
136 0.52
137 0.53
138 0.57
139 0.66
140 0.7
141 0.69
142 0.69
143 0.7
144 0.7
145 0.71
146 0.73
147 0.64
148 0.56
149 0.49
150 0.42
151 0.32
152 0.24
153 0.22
154 0.2
155 0.22
156 0.23
157 0.27
158 0.28
159 0.3
160 0.32
161 0.32
162 0.32
163 0.36
164 0.45
165 0.49
166 0.55
167 0.63
168 0.61
169 0.66
170 0.67
171 0.63
172 0.6
173 0.58
174 0.59
175 0.6
176 0.65
177 0.61
178 0.58
179 0.64
180 0.66
181 0.69
182 0.69
183 0.6
184 0.55
185 0.57
186 0.59
187 0.57
188 0.49