Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WU52

Protein Details
Accession A0A1Y1WU52    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
96-127LVEKVQQSRKQIKEKKNRGKKFRGTKKATQSKHydrophilic
NLS Segment(s)
PositionSequence
104-127RKQIKEKKNRGKKFRGTKKATQSK
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADACTIRTRKFMTNRLLQRKQMIVDIIHPNSANLSKNDLRDKLSKMYKADKENIFVFGFRTHFGGGKSTGYALIYDDIEAAKKFEPKYRLVRQGLVEKVQQSRKQIKEKKNRGKKFRGTKKATQSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.74
4 0.77
5 0.72
6 0.68
7 0.64
8 0.57
9 0.5
10 0.43
11 0.33
12 0.33
13 0.36
14 0.31
15 0.29
16 0.28
17 0.24
18 0.23
19 0.25
20 0.21
21 0.15
22 0.21
23 0.22
24 0.27
25 0.32
26 0.32
27 0.33
28 0.35
29 0.37
30 0.38
31 0.41
32 0.4
33 0.39
34 0.45
35 0.47
36 0.48
37 0.51
38 0.45
39 0.43
40 0.4
41 0.39
42 0.31
43 0.25
44 0.21
45 0.16
46 0.15
47 0.12
48 0.12
49 0.1
50 0.11
51 0.11
52 0.12
53 0.11
54 0.11
55 0.1
56 0.09
57 0.09
58 0.08
59 0.08
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.08
70 0.12
71 0.13
72 0.18
73 0.22
74 0.27
75 0.36
76 0.44
77 0.52
78 0.51
79 0.54
80 0.52
81 0.56
82 0.54
83 0.48
84 0.42
85 0.36
86 0.4
87 0.43
88 0.43
89 0.43
90 0.49
91 0.54
92 0.63
93 0.69
94 0.73
95 0.77
96 0.84
97 0.88
98 0.89
99 0.92
100 0.91
101 0.92
102 0.92
103 0.92
104 0.92
105 0.92
106 0.89
107 0.88