Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1XNB0

Protein Details
Accession A0A1Y1XNB0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
17-48DLPAEKKKKIINCLKCKAKPHNVNIRKNYPLCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019407  CTU2  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016779  F:nucleotidyltransferase activity  
GO:0000049  F:tRNA binding  
GO:0032447  P:protein urmylation  
GO:0034227  P:tRNA thio-modification  
GO:0002098  P:tRNA wobble uridine modification  
Pfam View protein in Pfam  
PF10288  CTU2  
Amino Acid Sequences MDSNKKINCRSDSSSEDLPAEKKKKIINCLKCKAKPHNVNIRKNYPLCKECFLSFMQHKFRTNIGQAKKVKKGVNVLIALSGGNCSRALLDIFYKYHKGAENPKSGKIQRFKDIAVAYIDDSIITGESHVQKIKEIVTPYDIPLLIRPIEDIFSISLDDNNDNYKIITVKNKDGKKELEISQNTNIDNKTAMKELYESIPLLADKECLINNIRLVLLNYMAKISKYPVLCLGDSSTKVAIDVISNTCKGRGSSLPEDIASETELLKDVVIIKPGKTLLKEEFIQYNEYFDLDYIPEKQYNSSEIAKSIDLISAGFISDLQENFPSTVTTVVSTANKITVEEENYSSYHCSLCLCPIRKDSEKWLASNSITEVKDRTDYNYDHTEVYKNIPKYYQYLCFNCHILIDSINLQENQTVYLPYYVAEKINKYISASSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.51
3 0.47
4 0.42
5 0.39
6 0.42
7 0.41
8 0.37
9 0.39
10 0.43
11 0.49
12 0.56
13 0.63
14 0.64
15 0.7
16 0.78
17 0.83
18 0.83
19 0.85
20 0.85
21 0.85
22 0.84
23 0.83
24 0.85
25 0.84
26 0.88
27 0.88
28 0.85
29 0.83
30 0.78
31 0.76
32 0.73
33 0.7
34 0.64
35 0.6
36 0.56
37 0.48
38 0.46
39 0.4
40 0.39
41 0.39
42 0.43
43 0.47
44 0.49
45 0.52
46 0.51
47 0.53
48 0.52
49 0.52
50 0.53
51 0.49
52 0.53
53 0.58
54 0.64
55 0.68
56 0.68
57 0.64
58 0.6
59 0.63
60 0.6
61 0.59
62 0.53
63 0.46
64 0.39
65 0.35
66 0.3
67 0.22
68 0.17
69 0.09
70 0.08
71 0.08
72 0.07
73 0.07
74 0.08
75 0.09
76 0.1
77 0.12
78 0.15
79 0.17
80 0.2
81 0.21
82 0.2
83 0.23
84 0.24
85 0.27
86 0.33
87 0.4
88 0.48
89 0.49
90 0.53
91 0.57
92 0.58
93 0.62
94 0.6
95 0.57
96 0.54
97 0.54
98 0.5
99 0.49
100 0.45
101 0.39
102 0.32
103 0.28
104 0.21
105 0.18
106 0.17
107 0.1
108 0.1
109 0.08
110 0.06
111 0.05
112 0.05
113 0.08
114 0.1
115 0.13
116 0.15
117 0.15
118 0.15
119 0.17
120 0.19
121 0.19
122 0.19
123 0.18
124 0.21
125 0.22
126 0.22
127 0.23
128 0.21
129 0.17
130 0.17
131 0.18
132 0.14
133 0.12
134 0.12
135 0.1
136 0.1
137 0.1
138 0.1
139 0.08
140 0.07
141 0.08
142 0.08
143 0.08
144 0.09
145 0.1
146 0.1
147 0.11
148 0.11
149 0.1
150 0.1
151 0.1
152 0.1
153 0.11
154 0.18
155 0.2
156 0.27
157 0.35
158 0.38
159 0.4
160 0.43
161 0.43
162 0.39
163 0.42
164 0.38
165 0.39
166 0.38
167 0.39
168 0.39
169 0.39
170 0.36
171 0.33
172 0.29
173 0.2
174 0.19
175 0.17
176 0.14
177 0.13
178 0.12
179 0.1
180 0.11
181 0.12
182 0.12
183 0.12
184 0.1
185 0.09
186 0.1
187 0.09
188 0.09
189 0.08
190 0.07
191 0.06
192 0.08
193 0.07
194 0.08
195 0.1
196 0.1
197 0.1
198 0.1
199 0.1
200 0.09
201 0.1
202 0.09
203 0.08
204 0.08
205 0.08
206 0.08
207 0.08
208 0.07
209 0.07
210 0.08
211 0.11
212 0.11
213 0.11
214 0.15
215 0.17
216 0.17
217 0.18
218 0.18
219 0.17
220 0.17
221 0.18
222 0.13
223 0.11
224 0.11
225 0.1
226 0.08
227 0.06
228 0.08
229 0.09
230 0.1
231 0.11
232 0.11
233 0.12
234 0.12
235 0.12
236 0.13
237 0.14
238 0.2
239 0.23
240 0.25
241 0.26
242 0.25
243 0.26
244 0.23
245 0.2
246 0.13
247 0.1
248 0.07
249 0.07
250 0.07
251 0.06
252 0.06
253 0.06
254 0.07
255 0.07
256 0.12
257 0.12
258 0.12
259 0.14
260 0.16
261 0.17
262 0.17
263 0.19
264 0.18
265 0.21
266 0.22
267 0.22
268 0.24
269 0.23
270 0.26
271 0.23
272 0.22
273 0.18
274 0.17
275 0.15
276 0.11
277 0.11
278 0.08
279 0.09
280 0.1
281 0.12
282 0.13
283 0.14
284 0.15
285 0.15
286 0.17
287 0.2
288 0.21
289 0.2
290 0.19
291 0.21
292 0.19
293 0.19
294 0.17
295 0.14
296 0.1
297 0.09
298 0.08
299 0.07
300 0.07
301 0.06
302 0.05
303 0.06
304 0.08
305 0.08
306 0.09
307 0.1
308 0.1
309 0.11
310 0.11
311 0.1
312 0.08
313 0.1
314 0.09
315 0.09
316 0.09
317 0.11
318 0.12
319 0.13
320 0.13
321 0.14
322 0.13
323 0.13
324 0.15
325 0.15
326 0.17
327 0.18
328 0.19
329 0.19
330 0.19
331 0.2
332 0.19
333 0.17
334 0.14
335 0.12
336 0.13
337 0.12
338 0.2
339 0.28
340 0.31
341 0.35
342 0.39
343 0.47
344 0.5
345 0.52
346 0.53
347 0.54
348 0.53
349 0.5
350 0.49
351 0.45
352 0.41
353 0.39
354 0.33
355 0.31
356 0.28
357 0.28
358 0.25
359 0.23
360 0.27
361 0.25
362 0.28
363 0.27
364 0.28
365 0.32
366 0.37
367 0.36
368 0.34
369 0.35
370 0.33
371 0.28
372 0.34
373 0.36
374 0.32
375 0.33
376 0.34
377 0.35
378 0.37
379 0.41
380 0.43
381 0.43
382 0.45
383 0.46
384 0.46
385 0.45
386 0.41
387 0.36
388 0.29
389 0.23
390 0.2
391 0.19
392 0.18
393 0.19
394 0.22
395 0.21
396 0.19
397 0.2
398 0.19
399 0.19
400 0.17
401 0.16
402 0.13
403 0.14
404 0.14
405 0.13
406 0.16
407 0.15
408 0.18
409 0.22
410 0.23
411 0.26
412 0.31
413 0.32
414 0.31