Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1WSD6

Protein Details
Accession A0A1Y1WSD6    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-40INGFSFFKKNKSNKENNFEPRQPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007292  Nuclear_fusion_Kar5  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0031965  C:nuclear membrane  
GO:0000742  P:karyogamy involved in conjugation with cellular fusion  
GO:0048288  P:nuclear membrane fusion involved in karyogamy  
Pfam View protein in Pfam  
PF04163  Tht1  
Amino Acid Sequences MNSKFMYLYLFCCFITSINGFSFFKKNKSNKENNFEPRQPIIDESKSEIKYNNLYLMSKRYEDFLSDNYGIQQENINHDVLTDFDIAINPSNIDVEYVNIYNRAINSFNKYTSKEDCFQNSIKTLKYGCLEMELDDNKKMEYAVELTLCELTSANISVPTECRHDQKNRSMAKCVENISRYSQLWTSYSGYFKDVVNMCYAIRYPLERNLLQNIHRNITKYQFNNMHVIASLYKREFLKIIELSEDYEVLLKYFYNKIIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.18
4 0.18
5 0.18
6 0.22
7 0.22
8 0.25
9 0.33
10 0.31
11 0.36
12 0.43
13 0.5
14 0.57
15 0.66
16 0.74
17 0.75
18 0.8
19 0.84
20 0.83
21 0.84
22 0.77
23 0.72
24 0.65
25 0.58
26 0.51
27 0.44
28 0.42
29 0.36
30 0.33
31 0.33
32 0.38
33 0.37
34 0.37
35 0.35
36 0.32
37 0.32
38 0.32
39 0.32
40 0.26
41 0.26
42 0.27
43 0.31
44 0.3
45 0.28
46 0.26
47 0.23
48 0.22
49 0.23
50 0.23
51 0.19
52 0.22
53 0.21
54 0.21
55 0.2
56 0.2
57 0.18
58 0.16
59 0.18
60 0.13
61 0.17
62 0.18
63 0.17
64 0.16
65 0.16
66 0.15
67 0.12
68 0.13
69 0.09
70 0.07
71 0.07
72 0.08
73 0.08
74 0.09
75 0.09
76 0.07
77 0.06
78 0.06
79 0.06
80 0.07
81 0.06
82 0.06
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.09
89 0.09
90 0.1
91 0.1
92 0.11
93 0.17
94 0.19
95 0.21
96 0.23
97 0.25
98 0.27
99 0.3
100 0.33
101 0.3
102 0.31
103 0.32
104 0.33
105 0.31
106 0.3
107 0.28
108 0.26
109 0.22
110 0.21
111 0.19
112 0.18
113 0.17
114 0.16
115 0.12
116 0.13
117 0.13
118 0.11
119 0.14
120 0.13
121 0.13
122 0.14
123 0.14
124 0.11
125 0.11
126 0.11
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.08
133 0.08
134 0.09
135 0.09
136 0.08
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.07
145 0.08
146 0.1
147 0.14
148 0.15
149 0.18
150 0.23
151 0.31
152 0.37
153 0.44
154 0.51
155 0.54
156 0.55
157 0.58
158 0.55
159 0.52
160 0.49
161 0.44
162 0.4
163 0.35
164 0.35
165 0.34
166 0.34
167 0.3
168 0.28
169 0.27
170 0.23
171 0.22
172 0.24
173 0.22
174 0.2
175 0.22
176 0.2
177 0.2
178 0.19
179 0.18
180 0.22
181 0.21
182 0.19
183 0.2
184 0.2
185 0.18
186 0.18
187 0.18
188 0.13
189 0.13
190 0.15
191 0.16
192 0.21
193 0.28
194 0.27
195 0.3
196 0.35
197 0.38
198 0.38
199 0.44
200 0.41
201 0.4
202 0.41
203 0.41
204 0.38
205 0.4
206 0.44
207 0.38
208 0.43
209 0.46
210 0.46
211 0.49
212 0.46
213 0.4
214 0.32
215 0.32
216 0.26
217 0.22
218 0.25
219 0.2
220 0.24
221 0.24
222 0.25
223 0.25
224 0.23
225 0.29
226 0.26
227 0.27
228 0.26
229 0.26
230 0.26
231 0.26
232 0.24
233 0.16
234 0.16
235 0.14
236 0.11
237 0.11
238 0.09
239 0.12
240 0.15