Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1WSA0

Protein Details
Accession A0A1Y1WSA0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-34AEANYVKGHYNRKRRIKCYKCNRYGHKADEHydrophilic
38-61KSNYKENHKNKNYRYHKNKKDEEDBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MNNNAEANYVKGHYNRKRRIKCYKCNRYGHKADEYGYKSNYKENHKNKNYRYHKNKKDEEDTYKYIDFAIEYDNYEEYKKISNLKPTILSVHRGVNKPENNRDNKDYLKLFNFYIIFNFSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.58
3 0.67
4 0.75
5 0.81
6 0.88
7 0.88
8 0.89
9 0.9
10 0.91
11 0.9
12 0.9
13 0.89
14 0.87
15 0.84
16 0.79
17 0.75
18 0.66
19 0.58
20 0.56
21 0.52
22 0.46
23 0.4
24 0.38
25 0.31
26 0.33
27 0.38
28 0.38
29 0.44
30 0.49
31 0.58
32 0.64
33 0.72
34 0.73
35 0.78
36 0.79
37 0.79
38 0.81
39 0.81
40 0.81
41 0.82
42 0.84
43 0.79
44 0.77
45 0.72
46 0.69
47 0.65
48 0.57
49 0.51
50 0.44
51 0.37
52 0.3
53 0.24
54 0.16
55 0.1
56 0.1
57 0.07
58 0.08
59 0.09
60 0.09
61 0.1
62 0.1
63 0.1
64 0.09
65 0.12
66 0.13
67 0.19
68 0.22
69 0.3
70 0.32
71 0.35
72 0.36
73 0.33
74 0.37
75 0.33
76 0.33
77 0.26
78 0.31
79 0.34
80 0.34
81 0.37
82 0.41
83 0.45
84 0.49
85 0.57
86 0.59
87 0.61
88 0.65
89 0.66
90 0.63
91 0.6
92 0.6
93 0.53
94 0.5
95 0.47
96 0.43
97 0.38
98 0.38
99 0.35
100 0.28
101 0.27